Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7204
Gene name
LocationContig_811:569..7631
Strand+
Gene length (bp)7062
Transcript length (bp)6915
Coding sequence length (bp)6915
Protein length (aa) 2305

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08326 ACC_central Acetyl-CoA carboxylase, central region 2.1E-282 767 1514
PF01039 Carboxyl_trans Carboxyl transferase domain 4.6E-40 1616 1771
PF01039 Carboxyl_trans Carboxyl transferase domain 1.6E-136 1786 2186
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 1.1E-51 229 412
PF00289 Biotin_carb_N Biotin carboxylase, N-terminal domain 1.5E-27 59 180
PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain 8.3E-20 456 563
PF00364 Biotin_lipoyl Biotin-requiring enzyme 1.6E-16 701 765

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78820|ACAC_SCHPO Acetyl-CoA carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut6 PE=1 SV=2 27 2298 0.0E+00
sp|Q00955|ACAC_YEAST Acetyl-CoA carboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACC1 PE=1 SV=2 20 2303 0.0E+00
sp|C7GRE4|HFA1_YEAS2 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=HFA1 PE=3 SV=2 24 2270 0.0E+00
sp|P32874|HFA1_YEAST Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFA1 PE=1 SV=2 24 2270 0.0E+00
sp|A6ZMR9|HFA1_YEAS7 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=HFA1 PE=3 SV=2 24 2270 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78820|ACAC_SCHPO Acetyl-CoA carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut6 PE=1 SV=2 27 2298 0.0E+00
sp|Q00955|ACAC_YEAST Acetyl-CoA carboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACC1 PE=1 SV=2 20 2303 0.0E+00
sp|C7GRE4|HFA1_YEAS2 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=HFA1 PE=3 SV=2 24 2270 0.0E+00
sp|P32874|HFA1_YEAST Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFA1 PE=1 SV=2 24 2270 0.0E+00
sp|A6ZMR9|HFA1_YEAS7 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=HFA1 PE=3 SV=2 24 2270 0.0E+00
sp|C8ZF72|HFA1_YEAS8 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=HFA1 PE=3 SV=2 24 2270 0.0E+00
sp|B3LM95|HFA1_YEAS1 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=HFA1 PE=3 SV=2 24 2270 0.0E+00
sp|P11029|ACAC_CHICK Acetyl-CoA carboxylase OS=Gallus gallus GN=ACAC PE=1 SV=1 48 2302 0.0E+00
sp|Q13085|ACACA_HUMAN Acetyl-CoA carboxylase 1 OS=Homo sapiens GN=ACACA PE=1 SV=2 48 2302 0.0E+00
sp|Q5SWU9|ACACA_MOUSE Acetyl-CoA carboxylase 1 OS=Mus musculus GN=Acaca PE=1 SV=1 48 2302 0.0E+00
sp|Q28559|ACACA_SHEEP Acetyl-CoA carboxylase 1 OS=Ovis aries GN=ACACA PE=2 SV=1 48 2302 0.0E+00
sp|Q9TTS3|ACACA_BOVIN Acetyl-CoA carboxylase 1 OS=Bos taurus GN=ACACA PE=2 SV=1 48 2302 0.0E+00
sp|O00763|ACACB_HUMAN Acetyl-CoA carboxylase 2 OS=Homo sapiens GN=ACACB PE=1 SV=3 48 2180 0.0E+00
sp|E9Q4Z2|ACACB_MOUSE Acetyl-CoA carboxylase 2 OS=Mus musculus GN=Acacb PE=1 SV=1 48 2188 0.0E+00
sp|P11497|ACACA_RAT Acetyl-CoA carboxylase 1 OS=Rattus norvegicus GN=Acaca PE=1 SV=1 48 2302 0.0E+00
sp|Q54J08|ACAC_DICDI Acetyl-CoA carboxylase OS=Dictyostelium discoideum GN=accA PE=3 SV=1 45 2304 0.0E+00
sp|Q38970|ACC1_ARATH Acetyl-CoA carboxylase 1 OS=Arabidopsis thaliana GN=ACC1 PE=1 SV=1 44 2304 0.0E+00
sp|Q8S6N5|ACC1_ORYSJ Acetyl-CoA carboxylase 1 OS=Oryza sativa subsp. japonica GN=ACC1 PE=3 SV=1 36 2304 0.0E+00
sp|F4I1L3|ACC2_ARATH Acetyl-CoA carboxylase 2 OS=Arabidopsis thaliana GN=ACC2 PE=2 SV=1 10 2195 0.0E+00
sp|B9FK36|ACC2_ORYSJ Acetyl-CoA carboxylase 2 OS=Oryza sativa subsp. japonica GN=ACC2 PE=3 SV=2 41 2197 0.0E+00
sp|Q06862|ACCC_NOSS1 Biotin carboxylase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=accC PE=3 SV=1 62 564 2.0E-71
sp|P05165|PCCA_HUMAN Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens GN=PCCA PE=1 SV=4 62 763 1.0E-69
sp|O27939|PYCA_METTH Pyruvate carboxylase subunit A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pycA PE=1 SV=1 58 563 7.0E-69
sp|P14882|PCCA_RAT Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Rattus norvegicus GN=Pcca PE=1 SV=3 62 763 4.0E-65
sp|Q91ZA3|PCCA_MOUSE Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus GN=Pcca PE=1 SV=2 62 763 5.0E-65
sp|Q96RQ3|MCCA_HUMAN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Homo sapiens GN=MCCC1 PE=1 SV=3 59 572 2.0E-61
sp|Q5I0C3|MCCA_RAT Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Rattus norvegicus GN=Mccc1 PE=1 SV=1 59 750 2.0E-61
sp|P9WPQ3|BCCA_MYCTU Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=accA1 PE=1 SV=1 61 763 4.0E-61
sp|P9WPQ2|BCCA_MYCTO Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=accA1 PE=3 SV=1 61 763 4.0E-61
sp|P0A509|BCCA_MYCBO Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=accA1 PE=3 SV=1 61 763 4.0E-61
sp|A5H0J2|DUR1_LACKL Urea amidolyase OS=Lachancea kluyveri GN=DUR1,2 PE=3 SV=1 61 562 2.0E-60
sp|P49787|ACCC1_BACSU Biotin carboxylase 1 OS=Bacillus subtilis (strain 168) GN=accC1 PE=3 SV=3 58 562 4.0E-60
sp|Q2QMG2|MCCA_ORYSJ Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=MCCA PE=2 SV=2 59 593 1.0E-59
sp|Q58626|PYCA_METJA Pyruvate carboxylase subunit A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pycA PE=1 SV=1 58 567 1.0E-59
sp|P32528|DUR1_YEAST Urea amidolyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR1,2 PE=1 SV=2 62 562 2.0E-59
sp|Q42523|MCCA_ARATH Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana GN=MCCA PE=1 SV=2 58 751 6.0E-59
sp|O34544|ACCC2_BACSU Biotin carboxylase 2 OS=Bacillus subtilis (strain 168) GN=accC2 PE=3 SV=1 58 563 2.0E-58
sp|B9HBA8|ACCC1_POPTR Biotin carboxylase 1, chloroplastic OS=Populus trichocarpa GN=POPTRDRAFT_831870 PE=2 SV=1 32 561 2.0E-58
sp|O04983|ACCC_ARATH Biotin carboxylase, chloroplastic OS=Arabidopsis thaliana GN=CAC2 PE=1 SV=1 62 561 1.0E-57
sp|Q99MR8|MCCA_MOUSE Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus GN=Mccc1 PE=1 SV=2 59 600 2.0E-57
sp|O52058|ACCC_ALLVD Biotin carboxylase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=accC PE=3 SV=2 58 565 4.0E-57
sp|P43873|ACCC_HAEIN Biotin carboxylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=accC PE=1 SV=1 58 563 5.0E-57
sp|Q54KE6|MCCA_DICDI Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=mccA PE=3 SV=1 59 561 2.0E-56
sp|B9N843|ACCC2_POPTR Biotin carboxylase 2, chloroplastic OS=Populus trichocarpa GN=POPTR_0018s14250g PE=2 SV=2 62 561 3.0E-56
sp|O30019|PYCA_ARCFU Pyruvate carboxylase subunit A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pycA PE=3 SV=1 58 563 4.0E-56
sp|Q42777|MCCA_SOYBN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Glycine max GN=MCCA PE=1 SV=2 59 562 6.0E-56
sp|Q9KWU4|PYC_BACSU Pyruvate carboxylase OS=Bacillus subtilis (strain 168) GN=pyc PE=3 SV=1 59 585 3.0E-55
sp|Q8X9B6|ACCC_ECO57 Biotin carboxylase OS=Escherichia coli O157:H7 GN=accC PE=3 SV=1 58 563 7.0E-55
sp|P24182|ACCC_ECOLI Biotin carboxylase OS=Escherichia coli (strain K12) GN=accC PE=1 SV=2 58 563 1.0E-54
sp|Q612F5|PCCA_CAEBR Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis briggsae GN=pcca-1 PE=3 SV=1 50 763 1.0E-54
sp|Q19842|PCCA_CAEEL Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis elegans GN=pcca-1 PE=1 SV=1 62 763 5.0E-54
sp|P32327|PYC2_YEAST Pyruvate carboxylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC2 PE=1 SV=2 44 563 3.0E-53
sp|D3DJ42|2OCS_HYDTT 2-oxoglutarate carboxylase small subunit OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=cfiB PE=1 SV=1 58 563 8.0E-53
sp|Q9KDS9|ACCC_BACHD Biotin carboxylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=accC PE=3 SV=1 61 561 7.0E-51
sp|O17732|PYC1_CAEEL Pyruvate carboxylase 1 OS=Caenorhabditis elegans GN=pyc-1 PE=1 SV=1 62 563 1.0E-50
sp|Q8X1T3|PYC_PICAN Pyruvate carboxylase OS=Pichia angusta GN=PYC PE=3 SV=1 44 591 2.0E-49
sp|Q29RK2|PYC_BOVIN Pyruvate carboxylase, mitochondrial OS=Bos taurus GN=PC PE=2 SV=2 59 563 2.0E-49
sp|P11498|PYC_HUMAN Pyruvate carboxylase, mitochondrial OS=Homo sapiens GN=PC PE=1 SV=2 59 563 2.0E-49
sp|P37798|ACCC_PSEAE Biotin carboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=accC PE=1 SV=1 58 563 3.0E-49
sp|Q05920|PYC_MOUSE Pyruvate carboxylase, mitochondrial OS=Mus musculus GN=Pc PE=1 SV=1 59 563 2.0E-48
sp|P52873|PYC_RAT Pyruvate carboxylase, mitochondrial OS=Rattus norvegicus GN=Pc PE=1 SV=2 59 563 2.0E-47
sp|P11154|PYC1_YEAST Pyruvate carboxylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC1 PE=1 SV=2 47 563 5.0E-47
sp|P46392|BCCA_MYCLE Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium leprae (strain TN) GN=bccA PE=3 SV=2 59 562 8.0E-47
sp|Q9UUE1|PYC_SCHPO Pyruvate carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pyr1 PE=3 SV=1 59 563 8.0E-47
sp|Q9HES8|PYC_ASPNG Pyruvate carboxylase OS=Aspergillus niger GN=pyc PE=3 SV=1 128 591 2.0E-46
sp|P38095|LAMA_EMENI Putative urea carboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lamA PE=2 SV=2 59 564 3.0E-46
sp|O93918|PYC_ASPTE Pyruvate carboxylase OS=Aspergillus terreus GN=pyc PE=2 SV=1 62 579 4.0E-45
sp|P78992|PYC_PICPA Pyruvate carboxylase OS=Komagataella pastoris GN=PYC1 PE=3 SV=1 128 590 4.0E-45
sp|Q0CLK1|PYC_ASPTN Pyruvate carboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pyc PE=3 SV=2 62 563 5.0E-45
sp|Q8U085|CARB_PYRFU Carbamoyl-phosphate synthase large chain OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=carB PE=3 SV=1 235 416 4.0E-10
sp|P05990|PYR1_DROME CAD protein OS=Drosophila melanogaster GN=r PE=1 SV=3 219 416 4.0E-09
sp|Q4J8E8|CARB_SULAC Carbamoyl-phosphate synthase large chain OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=carB PE=3 SV=1 233 414 8.0E-09
sp|Q4L5Q5|CARB_STAHJ Carbamoyl-phosphate synthase large chain OS=Staphylococcus haemolyticus (strain JCSC1435) GN=carB PE=3 SV=1 232 425 1.0E-08
sp|P58939|CARB_CORGL Carbamoyl-phosphate synthase large chain OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=carB PE=3 SV=1 227 416 2.0E-08
sp|O67869|CARB1_AQUAE Carbamoyl-phosphate synthase large chain, N-terminal section OS=Aquifex aeolicus (strain VF5) GN=carB1 PE=3 SV=1 229 416 3.0E-08
sp|A2BJL3|CARB_HYPBU Carbamoyl-phosphate synthase large chain OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=carB PE=3 SV=1 232 414 3.0E-08
sp|A1T8H1|CARB_MYCVP Carbamoyl-phosphate synthase large chain OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=carB PE=3 SV=1 229 416 4.0E-08
sp|P08955|PYR1_MESAU CAD protein OS=Mesocricetus auratus GN=CAD PE=1 SV=4 233 416 5.0E-08
sp|P9WQH6|PCC5_MYCTO Probable propionyl-CoA carboxylase beta chain 5 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=accD5 PE=3 SV=1 1809 2126 6.0E-08
sp|B2RQC6|PYR1_MOUSE CAD protein OS=Mus musculus GN=Cad PE=1 SV=1 233 416 6.0E-08
sp|P27708|PYR1_HUMAN CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3 233 416 9.0E-08
sp|A4TBY6|CARB_MYCGI Carbamoyl-phosphate synthase large chain OS=Mycobacterium gilvum (strain PYR-GCK) GN=carB PE=3 SV=1 229 416 1.0E-07
sp|B8H8U5|CARB_ARTCA Carbamoyl-phosphate synthase large chain OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=carB PE=3 SV=1 192 415 2.0E-07
sp|Q970U7|CARB_SULTO Carbamoyl-phosphate synthase large chain OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=carB PE=3 SV=1 233 414 2.0E-07
sp|P9WPK3|CARB_MYCTU Carbamoyl-phosphate synthase large chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=carB PE=1 SV=1 229 420 2.0E-07
sp|P9WPK2|CARB_MYCTO Carbamoyl-phosphate synthase large chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=carB PE=3 SV=1 229 420 2.0E-07
sp|Q827Q7|CARB_STRAW Carbamoyl-phosphate synthase large chain OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=carB PE=3 SV=1 229 420 3.0E-07
sp|Q1B9F9|CARB_MYCSS Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain MCS) GN=carB PE=3 SV=1 229 416 4.0E-07
sp|A1UFK4|CARB_MYCSK Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain KMS) GN=carB PE=3 SV=1 229 416 4.0E-07
sp|A3PZ65|CARB_MYCSJ Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain JLS) GN=carB PE=3 SV=1 229 416 4.0E-07
sp|Q7U054|CARB_MYCBO Carbamoyl-phosphate synthase large chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=carB PE=3 SV=1 229 420 4.0E-07
sp|A1R6Z3|CARB_ARTAT Carbamoyl-phosphate synthase large chain OS=Arthrobacter aurescens (strain TC1) GN=carB PE=3 SV=1 228 415 4.0E-07
sp|P9WQH7|PCC5_MYCTU Probable propionyl-CoA carboxylase beta chain 5 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=accD5 PE=1 SV=1 1809 2126 4.0E-07
sp|Q8FT42|CARB_COREF Carbamoyl-phosphate synthase large chain OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=carB PE=3 SV=1 227 415 5.0E-07
sp|Q9ZB63|CARY_GEOSE Carbamoyl-phosphate synthase arginine-specific large chain OS=Geobacillus stearothermophilus GN=carB PE=1 SV=1 205 414 5.0E-07
sp|Q1D6Y8|CARB_MYXXD Carbamoyl-phosphate synthase large chain OS=Myxococcus xanthus (strain DK 1622) GN=carB PE=3 SV=1 224 416 5.0E-07
sp|O28994|CARB_ARCFU Carbamoyl-phosphate synthase large chain OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=carB PE=3 SV=1 229 435 5.0E-07
sp|B2GI87|CARB_KOCRD Carbamoyl-phosphate synthase large chain OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=carB PE=3 SV=1 228 415 5.0E-07
sp|C3MW21|CARB_SULIM Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=carB PE=3 SV=1 233 414 5.0E-07
sp|C4KHM7|CARB_SULIK Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=carB PE=3 SV=1 233 414 5.0E-07
sp|C3N664|CARB_SULIA Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.16.27) GN=carB PE=3 SV=1 233 414 5.0E-07
sp|Q49WY4|CARB_STAS1 Carbamoyl-phosphate synthase large chain OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=carB PE=3 SV=1 232 425 7.0E-07
sp|C3NEM0|CARB_SULIY Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=carB PE=3 SV=1 233 414 8.0E-07
sp|C3MQE3|CARB_SULIL Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=carB PE=3 SV=1 233 414 8.0E-07
sp|C3NH23|CARB_SULIN Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=carB PE=3 SV=1 233 414 8.0E-07
sp|A0JX72|CARB_ARTS2 Carbamoyl-phosphate synthase large chain OS=Arthrobacter sp. (strain FB24) GN=carB PE=3 SV=1 192 415 1.0E-06
sp|Q91437|PYR1_SQUAC CAD protein OS=Squalus acanthias GN=CAD PE=2 SV=1 233 416 1.0E-06
sp|Q59969|CARB_SULSO Carbamoyl-phosphate synthase large chain OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=carB PE=3 SV=1 233 414 1.0E-06
sp|A9WSA8|CARB_RENSM Carbamoyl-phosphate synthase large chain OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=carB PE=3 SV=1 228 415 1.0E-06
sp|Q8K9Z7|CARB_BUCAP Carbamoyl-phosphate synthase large chain OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=carB PE=3 SV=3 229 435 1.0E-06
sp|C1A4I5|CARB_GEMAT Carbamoyl-phosphate synthase large chain OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=carB PE=3 SV=1 231 414 2.0E-06
sp|Q9WZ27|CARB_THEMA Carbamoyl-phosphate synthase large chain OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=carB PE=3 SV=1 230 414 2.0E-06
sp|C1A4I5|CARB_GEMAT Carbamoyl-phosphate synthase large chain OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=carB PE=3 SV=1 227 414 3.0E-06
sp|P07259|PYR1_YEAST Protein URA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA2 PE=1 SV=5 205 416 3.0E-06
sp|A5IJL8|CARB_THEP1 Carbamoyl-phosphate synthase large chain OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=carB PE=3 SV=1 230 414 3.0E-06
sp|C5CCF1|CARB_MICLC Carbamoyl-phosphate synthase large chain OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=carB PE=3 SV=1 196 420 3.0E-06
sp|B8D1H3|CARB_HALOH Carbamoyl-phosphate synthase large chain OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=carB PE=3 SV=1 231 420 4.0E-06
sp|Q1AVY9|CARB_RUBXD Carbamoyl-phosphate synthase large chain OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=carB PE=3 SV=1 231 414 4.0E-06
sp|Q9KXR6|CARB_STRCO Carbamoyl-phosphate synthase large chain OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=carB PE=3 SV=1 229 420 4.0E-06
sp|B2UX86|CARB_CLOBA Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=carB PE=3 SV=1 233 424 4.0E-06
sp|Q9CCR2|CARB_MYCLE Carbamoyl-phosphate synthase large chain OS=Mycobacterium leprae (strain TN) GN=carB PE=3 SV=2 229 415 4.0E-06
sp|Q1B9F9|CARB_MYCSS Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain MCS) GN=carB PE=3 SV=1 230 414 5.0E-06
sp|A1UFK4|CARB_MYCSK Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain KMS) GN=carB PE=3 SV=1 230 414 5.0E-06
sp|A3PZ65|CARB_MYCSJ Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain JLS) GN=carB PE=3 SV=1 230 414 5.0E-06
sp|B1L8T8|CARB_THESQ Carbamoyl-phosphate synthase large chain OS=Thermotoga sp. (strain RQ2) GN=carB PE=3 SV=1 230 414 5.0E-06
sp|B9KB91|CARB_THENN Carbamoyl-phosphate synthase large chain OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=carB PE=3 SV=1 229 449 5.0E-06
sp|B9KB91|CARB_THENN Carbamoyl-phosphate synthase large chain OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=carB PE=3 SV=1 230 414 6.0E-06
sp|B2UX86|CARB_CLOBA Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=carB PE=3 SV=1 221 416 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003989 acetyl-CoA carboxylase activity Yes
GO:0006633 fatty acid biosynthetic process Yes
GO:0030554 adenyl nucleotide binding No
GO:0032787 monocarboxylic acid metabolic process No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0008610 lipid biosynthetic process No
GO:0032553 ribonucleotide binding No
GO:0044255 cellular lipid metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043436 oxoacid metabolic process No
GO:0006631 fatty acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0043167 ion binding No
GO:0016053 organic acid biosynthetic process No
GO:0000166 nucleotide binding No
GO:0044249 cellular biosynthetic process No
GO:0006629 lipid metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0016421 CoA carboxylase activity No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0072330 monocarboxylic acid biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0009058 biosynthetic process No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0009987 cellular process No
GO:0016874 ligase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901576 organic substance biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0016885 ligase activity, forming carbon-carbon bonds No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2866
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7204 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|245
Ophiocordyceps camponoti-floridani Ophcf2|06939
Ophiocordyceps camponoti-rufipedis Ophun1|6439
Ophiocordyceps kimflemingae Ophio5|7967
Ophiocordyceps subramaniannii Hirsu2|4746

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7204
MPEVQNGVKERTVPVINGKASYAQKHKLADHFIGGNKLEKAPPSKVKDFVALNDGHTVITNVLIANNGIAAVKEI
RSVRKWAYETFGDERAIHFTVMATPEDLQANADYIRMADHYVEVPGGTNNHNYANVELIVDIAERMNVHAVWAGW
GHASENPKLPESLAASPNKIVFIGPPGSAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDAVKVDSSGIVTVSDAV
YAKGCVTSWQQGLEKAKEIGFPVMIKASEGGGGKGIRQAMSEENFESLYKAAASEIPGSPIFIMKLAGNARHLEV
QLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKAHTFKAMEDAAVRLGRLVGYVSAGTVEYLYSHADDKFY
FLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGLPLHRIRDIRLLYGVDPKASSEIDFDFKHEGSGQSQRRPTPT
GHTTACRITSEDPGEGFKPSNGVMHELNFRSSSNVWGYFSVGTQGGIHSFSDSQFGHIFAYGENRQASRKHMVVA
LKELSIRGDFRTTVEYLIKLLETEAFEDNTISTGWLDELISKRLTAERPDTMLAVVCGATTKAHVASEECIAVFR
SGLEKGQVPSKEILKTVFPIDFIYEGYRYKFTATRASADSYHLFINGSKCSVGVRALSDGGLLILLDGHSHNAYW
KEEVGATRLSVDGKTCLLEQENDPTQLRTPSPGKLVKYSVENGAHVKAGQAFAEVEVMKMYMPLVAQEDGIVQLI
KQPGAALEAGDILGILALDDPSRVKQAQAFVDKIPVYGDPVVVGNKPAQRFSVLRDILLNILMGYDNSVIMAPTL
KELIEVLRSPELPYSEWNAQFSALHARMPQKLDAQFTQVVERAKSRHVEFPAKTLQKTFQRFLDESVAASDAQML
KSTLAPLTEIIDTYSEGQKVRELNFIKNLLDEYYQVEKLFLSQAQDDGVILKLRDQNKDNINKVVQTVLSHSRVS
AKSSLVLAILEEYRPNKPNVGNVGKYLRDSLQKLTELSSRATSKVSLKAREIMIQCSLPSLEERTAQMEHILRSS
VVESRYGESGWDHREPNLDVIKEVVDSKYTVFDVLTLFFAHEDPWVSLASLEVYIRRAYRAYTLMQVEYHNDETD
SPQFVSWDFQLRKIGQSEFGLPVQSAAPSSPGTPISSEAGMKRIYSISDMSYLTNAWEDEPTRKGVIVPCKYLDE
ADELIQKALETLAFHSKQKKQSQGGQILADLSGKRKPLSAVKRDAKKDDELSAVINVAVRDAESRGDQEMLARIL
PIVQQFKTEMAARGVRRLTFICGHNDGSYPGYYTFRGPAYEEDDSIRHSEPALAFQLELARLGKFHIKPVFTENK
NIHVYEAMGKAVDTDKRYFTRAVIRPGRLRDEIPTAEYLISEADRVINDIFDALEIIGNNSSDLNHIFINFTPVF
QLDPQQVEQSLQGFLDRFGARGWRLRVSQVEIRIICTDPLTSTPYPLRVVVTNTSGYIVDVDMYAERKSEKGEWV
FHSIGGTKEKGPMHLLSVSTPYATKNALQPKRYKAHLMGTQYVYDFPELFRQAIQNCWVKAVKNRPALASQQPKV
GECITFTELVLDDKNNLDEVNREPGTNTCGMVGWIFKARTPEYPAGRRFIVVANDITYKIGSFGPKEDNFFNKCT
ELARKIGIPRIYLSANSGARLGLAEELMPHFKVAWNDASKPDSGFRYLYLDDKTRQRFKDDVITEEVSEDGEKRH
KIVTIVGQEDGLGVECLRGSGLIAGATSRAYNDIFTVTLVTCRSVGELVAYDDDDGDETNATLGIGAYLVRLGQR
AVQIEGQPIILTGAPALNNLLGREVYTSNLQLGGTQIMYRNGVSHMTANDDFAGVSKIVEWMSFVPEKRNGPVPV
SPSADEWDRDVTYCPPQRQPYDVRWMIAGKHEEDGSFQSGLFDRDSFVETLGGWARTVVVGRARLGGIPMGVIAV
ETRSIENIIPADPANPDSIEQVGNEAGGVWYPNSAFKTAQAINDFNYGEQLPLMILANWRGFSGGQRDMFNEVLK
YGSYIVDALVKFEQPIFVYIPPFGELRGGSWVVIDPTINETAMEMYADVEARGGVLEPEGIIGIKYRKDKQLATM
MRMDALYASLKKKLEADDVSAEEAAEVKKQMADREKLLLPVYAQIAVQFADLHDRAGRMKAKGTIREVLEWGNAR
RFFYWRLRRRLNEEYILKRMAATLMAPSSRDQGAGGAKAGEVRARNLHLLESWSRIAGWGGKDREVAEWYETERK
AIGEKLEAFKAEQLAAEVAEVVRSNKEAGWKGVREVLRVMPVEEREAMLKFLRE*
Coding >OphauG2|7204
ATGCCTGAAGTACAGAATGGCGTCAAGGAGCGGACGGTGCCTGTCATCAACGGCAAGGCGTCGTATGCCCAGAAG
CACAAGCTTGCAGACCACTTTATTGGCGGCAACAAGCTAGAAAAGGCTCCCCCGAGCAAGGTCAAGGACTTTGTC
GCTCTGAATGACGGCCATACCGTTATTACAAACGTTTTAATCGCAAACAATGGCATCGCTGCCGTCAAGGAGATT
CGGTCTGTTCGAAAATGGGCATACGAGACTTTTGGCGACGAAAGAGCAATTCACTTTACCGTCATGGCCACGCCT
GAAGATTTACAAGCCAACGCCGACTACATTCGCATGGCAGACCACTACGTCGAAGTCCCCGGAGGAACCAATAAC
CACAACTACGCCAATGTTGAGCTCATTGTCGATATTGCCGAACGTATGAATGTTCATGCAGTCTGGGCTGGCTGG
GGACACGCGTCGGAGAACCCAAAGCTCCCCGAGTCGCTTGCTGCATCACCAAACAAGATTGTCTTTATTGGCCCC
CCTGGCTCAGCCATGCGCTCTCTCGGAGACAAGATTTCCTCCACCATTGTGGCACAACACGCCAAAGTGCCATGC
ATTCCTTGGTCTGGAACAGGCGTCGACGCCGTCAAGGTTGACTCTTCGGGAATAGTAACGGTTTCGGACGCTGTC
TACGCCAAGGGCTGTGTTACGTCGTGGCAACAAGGCTTGGAAAAGGCCAAGGAGATTGGCTTCCCCGTCATGATC
AAGGCGTCTGAAGGTGGCGGCGGCAAGGGCATTCGTCAAGCCATGAGCGAGGAAAACTTTGAATCGCTATACAAG
GCGGCCGCCAGCGAGATTCCCGGCTCCCCCATCTTCATCATGAAGCTGGCGGGCAATGCTCGACATCTCGAAGTC
CAACTTCTTGCCGATCAGTACGGCAACAATATCTCCCTATTTGGCCGTGACTGTTCCGTCCAGCGACGCCATCAA
AAGATTATTGAAGAGGCGCCCGTCACCATTGCCAAGGCGCATACCTTTAAAGCCATGGAGGACGCTGCTGTTCGC
CTTGGCAGGCTTGTCGGCTATGTCTCTGCTGGAACAGTCGAATACCTATACTCTCACGCTGACGACAAGTTTTAT
TTTCTTGAGCTCAATCCCCGTCTTCAAGTAGAGCATCCTACTACTGAGATGGTTAGCGGTGTTAATTTACCTGCT
GCCCAGCTTCAGATTGCCATGGGCCTGCCTCTGCATCGAATTCGAGATATTCGGCTTCTCTACGGCGTCGACCCC
AAAGCGTCGAGCGAGATTGACTTTGACTTCAAGCACGAGGGATCCGGTCAGTCTCAGCGCCGCCCAACTCCTACC
GGCCATACCACAGCTTGCCGCATTACATCGGAGGATCCTGGCGAAGGCTTCAAGCCCTCCAATGGCGTTATGCAT
GAACTCAACTTTCGCAGCAGTTCCAATGTGTGGGGTTACTTCTCCGTCGGTACCCAGGGCGGCATCCACAGCTTC
TCGGACAGCCAGTTTGGCCACATCTTTGCATATGGCGAAAACCGGCAGGCCTCTCGCAAGCACATGGTTGTTGCT
CTCAAGGAGCTGAGCATTCGTGGCGACTTTCGCACCACGGTGGAGTACCTCATCAAGCTTCTCGAGACGGAGGCC
TTTGAGGACAATACCATTTCGACTGGCTGGCTCGACGAACTCATTTCGAAGCGCCTGACTGCCGAGAGACCCGAC
ACCATGCTTGCCGTCGTTTGCGGTGCGACGACAAAGGCGCACGTGGCCAGCGAGGAATGCATAGCTGTCTTTCGC
TCGGGCCTCGAAAAGGGCCAGGTTCCGTCAAAGGAGATTCTCAAGACAGTCTTTCCCATTGACTTTATATACGAG
GGCTACCGCTACAAGTTTACCGCGACTCGTGCTAGCGCTGACAGCTACCACCTCTTTATTAATGGCTCCAAGTGT
TCAGTCGGGGTTCGTGCCCTCTCGGACGGCGGACTGCTGATTCTGCTTGATGGCCACAGTCACAATGCGTATTGG
AAGGAAGAGGTTGGCGCCACACGACTGTCTGTCGATGGCAAGACGTGTCTGCTGGAGCAGGAAAACGACCCCACG
CAGCTTCGGACGCCTAGCCCTGGAAAGCTTGTCAAGTACTCGGTTGAGAATGGCGCCCACGTCAAGGCTGGCCAA
GCGTTTGCCGAAGTCGAAGTCATGAAGATGTACATGCCTCTGGTTGCTCAAGAAGACGGCATTGTCCAGCTCATT
AAGCAGCCCGGCGCAGCGCTGGAGGCGGGCGACATCTTGGGCATTCTCGCTCTCGACGATCCGAGCAGAGTCAAG
CAGGCCCAAGCCTTTGTGGACAAGATTCCAGTATATGGCGACCCTGTTGTTGTGGGCAACAAGCCCGCCCAGCGC
TTTAGCGTGCTGCGAGACATTTTGCTCAACATCTTGATGGGTTATGACAACTCAGTCATCATGGCGCCAACTCTC
AAGGAGCTCATTGAAGTGTTGCGGAGCCCAGAGTTGCCATATAGCGAATGGAATGCCCAGTTCTCGGCTCTTCAC
GCGCGCATGCCTCAGAAGCTTGATGCCCAGTTCACACAGGTTGTCGAGCGAGCCAAGTCGCGCCATGTCGAGTTT
CCAGCAAAGACTCTGCAAAAGACTTTTCAAAGGTTTCTTGACGAGAGCGTGGCTGCCAGTGACGCCCAGATGCTC
AAGTCGACGCTGGCTCCGCTGACGGAAATCATTGACACGTATTCCGAAGGCCAAAAGGTGCGGGAGCTCAACTTC
ATCAAGAACCTGCTGGATGAGTATTACCAGGTGGAAAAGCTTTTCCTGAGCCAGGCACAAGACGACGGCGTCATT
CTCAAGCTCCGCGACCAGAACAAGGACAATATCAACAAAGTGGTCCAAACAGTGCTTTCACATAGCCGAGTAAGC
GCCAAGAGTTCGCTTGTGTTGGCCATTCTGGAAGAGTACCGGCCAAACAAGCCCAATGTGGGCAATGTTGGCAAG
TACCTGCGCGACTCGCTGCAGAAGCTTACGGAGCTCTCGTCGCGCGCAACGTCCAAGGTGTCCTTGAAAGCTCGC
GAGATTATGATTCAGTGTTCTCTGCCCTCGCTGGAGGAGCGTACGGCGCAGATGGAGCATATTCTCCGCTCCTCT
GTCGTTGAGTCGCGGTATGGCGAGAGCGGCTGGGATCACCGCGAACCGAACCTCGATGTGATCAAGGAGGTCGTC
GACTCCAAGTACACCGTGTTTGACGTGCTGACCCTCTTTTTTGCCCACGAGGATCCCTGGGTGTCGCTGGCATCG
CTAGAGGTTTACATTCGGCGCGCCTACCGTGCCTACACGCTCATGCAAGTCGAGTACCACAATGACGAGACGGAC
TCTCCCCAATTTGTGTCTTGGGACTTTCAGCTGCGCAAGATTGGCCAGTCGGAGTTTGGGCTGCCAGTGCAGTCG
GCAGCACCGTCTTCTCCTGGCACGCCCATCAGCTCGGAGGCTGGCATGAAGCGCATCTACTCCATCAGCGACATG
TCGTATCTCACCAATGCATGGGAGGATGAACCGACACGCAAGGGCGTCATTGTGCCCTGCAAGTACCTCGACGAG
GCGGATGAACTGATTCAAAAGGCGCTCGAGACTCTTGCCTTTCACAGCAAGCAAAAGAAGCAGAGCCAGGGCGGC
CAAATCCTTGCCGATCTCAGTGGCAAGCGCAAGCCACTGAGCGCCGTTAAGCGGGATGCCAAGAAGGACGACGAA
TTGTCAGCCGTTATCAACGTGGCAGTGCGCGACGCTGAAAGCAGAGGTGACCAGGAGATGCTGGCGCGTATTTTG
CCCATTGTCCAACAGTTCAAGACGGAAATGGCAGCGCGCGGCGTGCGACGCTTGACCTTTATCTGCGGCCACAAT
GATGGCTCGTATCCCGGATACTACACGTTTCGCGGTCCGGCATACGAGGAAGATGACAGCATTCGTCACAGCGAG
CCAGCGCTTGCTTTCCAGCTCGAGCTGGCTCGCCTGGGCAAGTTTCACATCAAGCCCGTCTTTACCGAGAACAAG
AACATCCACGTGTACGAGGCCATGGGAAAGGCTGTGGACACGGACAAGCGCTACTTTACGCGTGCAGTCATTCGG
CCCGGGCGTCTTCGAGACGAGATTCCCACGGCAGAGTATCTCATTTCCGAAGCGGACCGCGTCATCAATGACATT
TTTGACGCTCTGGAAATCATTGGCAACAACTCGTCCGACTTGAATCACATCTTTATCAACTTTACTCCCGTCTTC
CAGCTGGACCCGCAACAAGTAGAACAGAGTCTTCAGGGATTCCTGGACCGCTTTGGTGCGCGTGGATGGCGGCTC
AGGGTTTCGCAGGTTGAAATTCGCATCATTTGCACCGATCCCCTGACGAGCACTCCCTATCCCCTTCGCGTCGTG
GTGACGAATACGTCTGGCTACATTGTCGATGTTGACATGTATGCCGAGCGCAAGTCGGAAAAGGGCGAGTGGGTC
TTCCACAGCATTGGCGGTACCAAGGAGAAGGGGCCTATGCACCTGTTGTCTGTATCGACGCCGTATGCGACCAAG
AATGCTCTCCAGCCAAAACGCTACAAGGCGCATCTCATGGGCACGCAATACGTCTACGACTTTCCCGAGCTCTTT
CGCCAGGCCATTCAAAACTGCTGGGTCAAGGCGGTCAAGAACCGGCCGGCCCTGGCTTCTCAGCAGCCCAAGGTG
GGCGAGTGCATCACGTTTACCGAGCTGGTCCTTGATGATAAGAACAACCTGGACGAAGTGAACCGCGAGCCTGGC
ACCAATACCTGCGGCATGGTGGGCTGGATCTTCAAGGCTCGCACGCCCGAATATCCTGCAGGCCGGCGGTTTATT
GTGGTGGCCAATGACATTACCTACAAGATTGGGTCGTTTGGCCCCAAGGAGGACAACTTTTTCAACAAGTGCACT
GAGCTTGCCCGCAAGATTGGCATCCCACGCATCTACCTGTCGGCCAACTCTGGAGCTCGCTTGGGCCTCGCTGAA
GAGCTCATGCCACACTTCAAGGTGGCGTGGAACGACGCCAGCAAGCCAGACAGCGGCTTCCGGTACCTGTATCTG
GACGACAAGACGCGGCAGAGATTCAAGGATGACGTGATTACCGAAGAGGTTTCAGAAGATGGCGAGAAGCGTCAC
AAGATTGTCACGATTGTGGGGCAGGAAGATGGCCTCGGTGTCGAGTGTCTGAGGGGGTCTGGTCTCATTGCGGGC
GCGACGAGTCGGGCTTACAACGACATTTTCACGGTGACGCTTGTGACTTGTCGATCTGTCGGTGAGTTGGTTGCA
TATGATGATGATGATGGCGATGAGACTAATGCGACGTTAGGTATCGGGGCGTACCTGGTGCGTCTTGGGCAGCGG
GCGGTGCAAATCGAGGGCCAGCCGATTATTCTGACTGGGGCGCCTGCGCTCAACAACCTGCTTGGGCGAGAAGTT
TACACGTCCAATCTGCAGCTGGGAGGCACGCAAATCATGTACCGCAACGGAGTGTCTCACATGACTGCCAATGAT
GACTTTGCTGGTGTCTCAAAGATTGTCGAATGGATGTCATTTGTGCCCGAAAAGCGAAACGGGCCTGTTCCGGTC
AGCCCGAGCGCCGACGAGTGGGACCGCGATGTGACATACTGCCCACCGCAGAGACAGCCATACGACGTCAGGTGG
ATGATTGCCGGCAAGCATGAAGAGGACGGCAGCTTCCAGAGCGGTCTGTTTGACAGGGATTCGTTTGTTGAGACG
CTAGGCGGTTGGGCGCGCACAGTGGTTGTTGGGCGTGCTCGGCTGGGTGGCATCCCCATGGGTGTTATTGCAGTT
GAGACGCGGTCGATTGAGAACATTATTCCGGCTGACCCTGCCAATCCCGACTCGATTGAGCAAGTGGGCAACGAG
GCGGGAGGCGTCTGGTATCCCAACTCGGCCTTTAAGACGGCACAAGCCATTAATGACTTTAATTATGGCGAACAG
CTGCCGCTCATGATTCTGGCCAACTGGCGCGGGTTTTCGGGCGGCCAGCGCGACATGTTCAACGAGGTGTTGAAG
TATGGCTCGTATATTGTGGACGCGCTCGTCAAGTTTGAGCAGCCAATCTTTGTCTACATTCCTCCCTTTGGCGAG
CTCCGGGGCGGGTCATGGGTGGTTATTGACCCGACCATCAACGAGACTGCCATGGAGATGTATGCCGACGTTGAG
GCGCGGGGAGGCGTCTTGGAGCCCGAAGGCATCATTGGAATCAAGTATCGCAAAGACAAGCAGCTTGCAACCATG
ATGCGCATGGACGCCTTGTACGCGAGCTTGAAGAAGAAGCTTGAGGCCGACGACGTGTCTGCGGAAGAGGCAGCC
GAGGTGAAGAAGCAAATGGCGGATCGGGAGAAGCTGCTGCTGCCCGTGTATGCGCAGATTGCGGTGCAGTTTGCC
GACTTGCATGACCGGGCTGGGCGCATGAAGGCCAAGGGCACCATTCGCGAGGTGCTGGAGTGGGGGAATGCGCGG
CGCTTCTTTTACTGGCGGCTGCGGCGACGGTTGAATGAAGAGTATATCCTCAAGCGCATGGCGGCGACGCTGATG
GCACCGTCGTCGAGAGACCAAGGAGCAGGGGGAGCCAAGGCGGGCGAGGTGCGAGCGCGCAACTTGCACCTGCTC
GAGTCGTGGTCGCGCATTGCTGGGTGGGGGGGCAAGGACCGCGAGGTTGCCGAGTGGTACGAGACGGAGCGCAAG
GCGATTGGCGAAAAGCTCGAGGCGTTCAAGGCGGAGCAGTTGGCTGCCGAGGTGGCGGAAGTGGTGCGCAGCAAC
AAGGAGGCTGGGTGGAAGGGAGTGCGCGAGGTGCTTCGGGTAATGCCAGTGGAGGAGCGCGAGGCCATGCTCAAG
TTTTTGAGGGAGTAG
Transcript >OphauG2|7204
ATGCCTGAAGTACAGAATGGCGTCAAGGAGCGGACGGTGCCTGTCATCAACGGCAAGGCGTCGTATGCCCAGAAG
CACAAGCTTGCAGACCACTTTATTGGCGGCAACAAGCTAGAAAAGGCTCCCCCGAGCAAGGTCAAGGACTTTGTC
GCTCTGAATGACGGCCATACCGTTATTACAAACGTTTTAATCGCAAACAATGGCATCGCTGCCGTCAAGGAGATT
CGGTCTGTTCGAAAATGGGCATACGAGACTTTTGGCGACGAAAGAGCAATTCACTTTACCGTCATGGCCACGCCT
GAAGATTTACAAGCCAACGCCGACTACATTCGCATGGCAGACCACTACGTCGAAGTCCCCGGAGGAACCAATAAC
CACAACTACGCCAATGTTGAGCTCATTGTCGATATTGCCGAACGTATGAATGTTCATGCAGTCTGGGCTGGCTGG
GGACACGCGTCGGAGAACCCAAAGCTCCCCGAGTCGCTTGCTGCATCACCAAACAAGATTGTCTTTATTGGCCCC
CCTGGCTCAGCCATGCGCTCTCTCGGAGACAAGATTTCCTCCACCATTGTGGCACAACACGCCAAAGTGCCATGC
ATTCCTTGGTCTGGAACAGGCGTCGACGCCGTCAAGGTTGACTCTTCGGGAATAGTAACGGTTTCGGACGCTGTC
TACGCCAAGGGCTGTGTTACGTCGTGGCAACAAGGCTTGGAAAAGGCCAAGGAGATTGGCTTCCCCGTCATGATC
AAGGCGTCTGAAGGTGGCGGCGGCAAGGGCATTCGTCAAGCCATGAGCGAGGAAAACTTTGAATCGCTATACAAG
GCGGCCGCCAGCGAGATTCCCGGCTCCCCCATCTTCATCATGAAGCTGGCGGGCAATGCTCGACATCTCGAAGTC
CAACTTCTTGCCGATCAGTACGGCAACAATATCTCCCTATTTGGCCGTGACTGTTCCGTCCAGCGACGCCATCAA
AAGATTATTGAAGAGGCGCCCGTCACCATTGCCAAGGCGCATACCTTTAAAGCCATGGAGGACGCTGCTGTTCGC
CTTGGCAGGCTTGTCGGCTATGTCTCTGCTGGAACAGTCGAATACCTATACTCTCACGCTGACGACAAGTTTTAT
TTTCTTGAGCTCAATCCCCGTCTTCAAGTAGAGCATCCTACTACTGAGATGGTTAGCGGTGTTAATTTACCTGCT
GCCCAGCTTCAGATTGCCATGGGCCTGCCTCTGCATCGAATTCGAGATATTCGGCTTCTCTACGGCGTCGACCCC
AAAGCGTCGAGCGAGATTGACTTTGACTTCAAGCACGAGGGATCCGGTCAGTCTCAGCGCCGCCCAACTCCTACC
GGCCATACCACAGCTTGCCGCATTACATCGGAGGATCCTGGCGAAGGCTTCAAGCCCTCCAATGGCGTTATGCAT
GAACTCAACTTTCGCAGCAGTTCCAATGTGTGGGGTTACTTCTCCGTCGGTACCCAGGGCGGCATCCACAGCTTC
TCGGACAGCCAGTTTGGCCACATCTTTGCATATGGCGAAAACCGGCAGGCCTCTCGCAAGCACATGGTTGTTGCT
CTCAAGGAGCTGAGCATTCGTGGCGACTTTCGCACCACGGTGGAGTACCTCATCAAGCTTCTCGAGACGGAGGCC
TTTGAGGACAATACCATTTCGACTGGCTGGCTCGACGAACTCATTTCGAAGCGCCTGACTGCCGAGAGACCCGAC
ACCATGCTTGCCGTCGTTTGCGGTGCGACGACAAAGGCGCACGTGGCCAGCGAGGAATGCATAGCTGTCTTTCGC
TCGGGCCTCGAAAAGGGCCAGGTTCCGTCAAAGGAGATTCTCAAGACAGTCTTTCCCATTGACTTTATATACGAG
GGCTACCGCTACAAGTTTACCGCGACTCGTGCTAGCGCTGACAGCTACCACCTCTTTATTAATGGCTCCAAGTGT
TCAGTCGGGGTTCGTGCCCTCTCGGACGGCGGACTGCTGATTCTGCTTGATGGCCACAGTCACAATGCGTATTGG
AAGGAAGAGGTTGGCGCCACACGACTGTCTGTCGATGGCAAGACGTGTCTGCTGGAGCAGGAAAACGACCCCACG
CAGCTTCGGACGCCTAGCCCTGGAAAGCTTGTCAAGTACTCGGTTGAGAATGGCGCCCACGTCAAGGCTGGCCAA
GCGTTTGCCGAAGTCGAAGTCATGAAGATGTACATGCCTCTGGTTGCTCAAGAAGACGGCATTGTCCAGCTCATT
AAGCAGCCCGGCGCAGCGCTGGAGGCGGGCGACATCTTGGGCATTCTCGCTCTCGACGATCCGAGCAGAGTCAAG
CAGGCCCAAGCCTTTGTGGACAAGATTCCAGTATATGGCGACCCTGTTGTTGTGGGCAACAAGCCCGCCCAGCGC
TTTAGCGTGCTGCGAGACATTTTGCTCAACATCTTGATGGGTTATGACAACTCAGTCATCATGGCGCCAACTCTC
AAGGAGCTCATTGAAGTGTTGCGGAGCCCAGAGTTGCCATATAGCGAATGGAATGCCCAGTTCTCGGCTCTTCAC
GCGCGCATGCCTCAGAAGCTTGATGCCCAGTTCACACAGGTTGTCGAGCGAGCCAAGTCGCGCCATGTCGAGTTT
CCAGCAAAGACTCTGCAAAAGACTTTTCAAAGGTTTCTTGACGAGAGCGTGGCTGCCAGTGACGCCCAGATGCTC
AAGTCGACGCTGGCTCCGCTGACGGAAATCATTGACACGTATTCCGAAGGCCAAAAGGTGCGGGAGCTCAACTTC
ATCAAGAACCTGCTGGATGAGTATTACCAGGTGGAAAAGCTTTTCCTGAGCCAGGCACAAGACGACGGCGTCATT
CTCAAGCTCCGCGACCAGAACAAGGACAATATCAACAAAGTGGTCCAAACAGTGCTTTCACATAGCCGAGTAAGC
GCCAAGAGTTCGCTTGTGTTGGCCATTCTGGAAGAGTACCGGCCAAACAAGCCCAATGTGGGCAATGTTGGCAAG
TACCTGCGCGACTCGCTGCAGAAGCTTACGGAGCTCTCGTCGCGCGCAACGTCCAAGGTGTCCTTGAAAGCTCGC
GAGATTATGATTCAGTGTTCTCTGCCCTCGCTGGAGGAGCGTACGGCGCAGATGGAGCATATTCTCCGCTCCTCT
GTCGTTGAGTCGCGGTATGGCGAGAGCGGCTGGGATCACCGCGAACCGAACCTCGATGTGATCAAGGAGGTCGTC
GACTCCAAGTACACCGTGTTTGACGTGCTGACCCTCTTTTTTGCCCACGAGGATCCCTGGGTGTCGCTGGCATCG
CTAGAGGTTTACATTCGGCGCGCCTACCGTGCCTACACGCTCATGCAAGTCGAGTACCACAATGACGAGACGGAC
TCTCCCCAATTTGTGTCTTGGGACTTTCAGCTGCGCAAGATTGGCCAGTCGGAGTTTGGGCTGCCAGTGCAGTCG
GCAGCACCGTCTTCTCCTGGCACGCCCATCAGCTCGGAGGCTGGCATGAAGCGCATCTACTCCATCAGCGACATG
TCGTATCTCACCAATGCATGGGAGGATGAACCGACACGCAAGGGCGTCATTGTGCCCTGCAAGTACCTCGACGAG
GCGGATGAACTGATTCAAAAGGCGCTCGAGACTCTTGCCTTTCACAGCAAGCAAAAGAAGCAGAGCCAGGGCGGC
CAAATCCTTGCCGATCTCAGTGGCAAGCGCAAGCCACTGAGCGCCGTTAAGCGGGATGCCAAGAAGGACGACGAA
TTGTCAGCCGTTATCAACGTGGCAGTGCGCGACGCTGAAAGCAGAGGTGACCAGGAGATGCTGGCGCGTATTTTG
CCCATTGTCCAACAGTTCAAGACGGAAATGGCAGCGCGCGGCGTGCGACGCTTGACCTTTATCTGCGGCCACAAT
GATGGCTCGTATCCCGGATACTACACGTTTCGCGGTCCGGCATACGAGGAAGATGACAGCATTCGTCACAGCGAG
CCAGCGCTTGCTTTCCAGCTCGAGCTGGCTCGCCTGGGCAAGTTTCACATCAAGCCCGTCTTTACCGAGAACAAG
AACATCCACGTGTACGAGGCCATGGGAAAGGCTGTGGACACGGACAAGCGCTACTTTACGCGTGCAGTCATTCGG
CCCGGGCGTCTTCGAGACGAGATTCCCACGGCAGAGTATCTCATTTCCGAAGCGGACCGCGTCATCAATGACATT
TTTGACGCTCTGGAAATCATTGGCAACAACTCGTCCGACTTGAATCACATCTTTATCAACTTTACTCCCGTCTTC
CAGCTGGACCCGCAACAAGTAGAACAGAGTCTTCAGGGATTCCTGGACCGCTTTGGTGCGCGTGGATGGCGGCTC
AGGGTTTCGCAGGTTGAAATTCGCATCATTTGCACCGATCCCCTGACGAGCACTCCCTATCCCCTTCGCGTCGTG
GTGACGAATACGTCTGGCTACATTGTCGATGTTGACATGTATGCCGAGCGCAAGTCGGAAAAGGGCGAGTGGGTC
TTCCACAGCATTGGCGGTACCAAGGAGAAGGGGCCTATGCACCTGTTGTCTGTATCGACGCCGTATGCGACCAAG
AATGCTCTCCAGCCAAAACGCTACAAGGCGCATCTCATGGGCACGCAATACGTCTACGACTTTCCCGAGCTCTTT
CGCCAGGCCATTCAAAACTGCTGGGTCAAGGCGGTCAAGAACCGGCCGGCCCTGGCTTCTCAGCAGCCCAAGGTG
GGCGAGTGCATCACGTTTACCGAGCTGGTCCTTGATGATAAGAACAACCTGGACGAAGTGAACCGCGAGCCTGGC
ACCAATACCTGCGGCATGGTGGGCTGGATCTTCAAGGCTCGCACGCCCGAATATCCTGCAGGCCGGCGGTTTATT
GTGGTGGCCAATGACATTACCTACAAGATTGGGTCGTTTGGCCCCAAGGAGGACAACTTTTTCAACAAGTGCACT
GAGCTTGCCCGCAAGATTGGCATCCCACGCATCTACCTGTCGGCCAACTCTGGAGCTCGCTTGGGCCTCGCTGAA
GAGCTCATGCCACACTTCAAGGTGGCGTGGAACGACGCCAGCAAGCCAGACAGCGGCTTCCGGTACCTGTATCTG
GACGACAAGACGCGGCAGAGATTCAAGGATGACGTGATTACCGAAGAGGTTTCAGAAGATGGCGAGAAGCGTCAC
AAGATTGTCACGATTGTGGGGCAGGAAGATGGCCTCGGTGTCGAGTGTCTGAGGGGGTCTGGTCTCATTGCGGGC
GCGACGAGTCGGGCTTACAACGACATTTTCACGGTGACGCTTGTGACTTGTCGATCTGTCGGTGAGTTGGTTGCA
TATGATGATGATGATGGCGATGAGACTAATGCGACGTTAGGTATCGGGGCGTACCTGGTGCGTCTTGGGCAGCGG
GCGGTGCAAATCGAGGGCCAGCCGATTATTCTGACTGGGGCGCCTGCGCTCAACAACCTGCTTGGGCGAGAAGTT
TACACGTCCAATCTGCAGCTGGGAGGCACGCAAATCATGTACCGCAACGGAGTGTCTCACATGACTGCCAATGAT
GACTTTGCTGGTGTCTCAAAGATTGTCGAATGGATGTCATTTGTGCCCGAAAAGCGAAACGGGCCTGTTCCGGTC
AGCCCGAGCGCCGACGAGTGGGACCGCGATGTGACATACTGCCCACCGCAGAGACAGCCATACGACGTCAGGTGG
ATGATTGCCGGCAAGCATGAAGAGGACGGCAGCTTCCAGAGCGGTCTGTTTGACAGGGATTCGTTTGTTGAGACG
CTAGGCGGTTGGGCGCGCACAGTGGTTGTTGGGCGTGCTCGGCTGGGTGGCATCCCCATGGGTGTTATTGCAGTT
GAGACGCGGTCGATTGAGAACATTATTCCGGCTGACCCTGCCAATCCCGACTCGATTGAGCAAGTGGGCAACGAG
GCGGGAGGCGTCTGGTATCCCAACTCGGCCTTTAAGACGGCACAAGCCATTAATGACTTTAATTATGGCGAACAG
CTGCCGCTCATGATTCTGGCCAACTGGCGCGGGTTTTCGGGCGGCCAGCGCGACATGTTCAACGAGGTGTTGAAG
TATGGCTCGTATATTGTGGACGCGCTCGTCAAGTTTGAGCAGCCAATCTTTGTCTACATTCCTCCCTTTGGCGAG
CTCCGGGGCGGGTCATGGGTGGTTATTGACCCGACCATCAACGAGACTGCCATGGAGATGTATGCCGACGTTGAG
GCGCGGGGAGGCGTCTTGGAGCCCGAAGGCATCATTGGAATCAAGTATCGCAAAGACAAGCAGCTTGCAACCATG
ATGCGCATGGACGCCTTGTACGCGAGCTTGAAGAAGAAGCTTGAGGCCGACGACGTGTCTGCGGAAGAGGCAGCC
GAGGTGAAGAAGCAAATGGCGGATCGGGAGAAGCTGCTGCTGCCCGTGTATGCGCAGATTGCGGTGCAGTTTGCC
GACTTGCATGACCGGGCTGGGCGCATGAAGGCCAAGGGCACCATTCGCGAGGTGCTGGAGTGGGGGAATGCGCGG
CGCTTCTTTTACTGGCGGCTGCGGCGACGGTTGAATGAAGAGTATATCCTCAAGCGCATGGCGGCGACGCTGATG
GCACCGTCGTCGAGAGACCAAGGAGCAGGGGGAGCCAAGGCGGGCGAGGTGCGAGCGCGCAACTTGCACCTGCTC
GAGTCGTGGTCGCGCATTGCTGGGTGGGGGGGCAAGGACCGCGAGGTTGCCGAGTGGTACGAGACGGAGCGCAAG
GCGATTGGCGAAAAGCTCGAGGCGTTCAAGGCGGAGCAGTTGGCTGCCGAGGTGGCGGAAGTGGTGCGCAGCAAC
AAGGAGGCTGGGTGGAAGGGAGTGCGCGAGGTGCTTCGGGTAATGCCAGTGGAGGAGCGCGAGGCCATGCTCAAG
TTTTTGAGGGAGTAG
Gene >OphauG2|7204
ATGCCTGAAGTACAGAATGGCGTCAAGGAGCGGACGGTGCCTGTCATCAACGGCAAGGCGTCGTATGCCCAGAAG
CACAAGCTTGCAGACCACTTTATTGGCGGCAACAAGCTAGAAAAGGCTCCCCCGAGCAAGGTCAAGGACTTTGTC
GCTCTGAATGACGGCCATACCGTTATTACAAACGTGAGGAGTCCCGCTTGTCTGCTTGGTTTTTTTTTTTTGGTG
GAAAAAAGTGCCGCACAAGCTGCTAACCAGCCGGTTGCAATGTCAGGTTTTAATCGCAAACAATGGCATCGCTGC
CGTCAAGGAGATTCGGTCTGTTCGAAAATGGGCATACGAGACTTTTGGCGACGAAAGAGCAATTCACTTTACCGT
CATGGCCACGCCTGAAGATTTACAAGCCAACGCCGACTACATTCGCATGGCAGACCACTACGTCGAAGTCCCCGG
AGGAACCAATAACCACAACTACGCCAATGTTGAGCTCATTGTCGATATTGCCGAACGTATGAATGTTCATGCAGT
CTGGGCTGGCTGGTGAGCCGATAATCAAAAGCGCGAGGCTGGATGCTTTGGAACTAACTGGGCCGTGCTAGGGGA
CACGCGTCGGAGAACCCAAAGCTCCCCGAGTCGCTTGCTGCATCACCAAACAAGATTGTCTTTATTGGCCCCCCT
GGCTCAGCCATGCGCTCTCTCGGAGACAAGATTTCCTCCACCATTGTGGCACAACACGCCAAAGTGCCATGCATT
CCTTGGTCTGGAACAGGCGTCGACGCCGTCAAGGTTGACTCTTCGGGAATAGTAACGGTTTCGGACGCTGTCTAC
GCCAAGGGCTGTGTTACGTCGTGGCAACAAGGCTTGGAAAAGGCCAAGGAGATTGGCTTCCCCGTCATGATCAAG
GCGTCTGAAGGTGGCGGCGGCAAGGGCATTCGTCAAGCCATGAGCGAGGAAAACTTTGAATCGCTATACAAGGCG
GCCGCCAGCGAGATTCCCGGCTCCCCCATCTTCATCATGAAGCTGGCGGGCAATGCTCGACATCTCGAAGTCCAA
CTTCTTGCCGATCAGTACGGCAACAATATCTCCCTATTTGGCCGTGACTGTTCCGTCCAGCGACGCCATCAAAAG
ATTATTGAAGAGGCGCCCGTCACCATTGCCAAGGCGCATACCTTTAAAGCCATGGAGGACGCTGCTGTTCGCCTT
GGCAGGCTTGTCGGCTATGTCTCTGCTGGAACAGTCGAATACCTATACTCTCACGCTGACGACAAGTTTTATTTT
CTTGAGCTCAATCCCCGTCTTCAAGTAGAGCATCCTACTACTGAGATGGTTAGCGGTGTTAATTTACCTGCTGCC
CAGCTTCAGATTGCCATGGGCCTGCCTCTGCATCGAATTCGAGATATTCGGCTTCTCTACGGCGTCGACCCCAAA
GCGTCGAGCGAGATTGACTTTGACTTCAAGCACGAGGGATCCGGTCAGTCTCAGCGCCGCCCAACTCCTACCGGC
CATACCACAGCTTGCCGCATTACATCGGAGGATCCTGGCGAAGGCTTCAAGCCCTCCAATGGCGTTATGCATGAA
CTCAACTTTCGCAGCAGTTCCAATGTGTGGGGTTACTTCTCCGTCGGTACCCAGGGCGGCATCCACAGCTTCTCG
GACAGCCAGTTTGGCCACATCTTTGCATATGGCGAAAACCGGCAGGCCTCTCGCAAGCACATGGTTGTTGCTCTC
AAGGAGCTGAGCATTCGTGGCGACTTTCGCACCACGGTGGAGTACCTCATCAAGCTTCTCGAGACGGAGGCCTTT
GAGGACAATACCATTTCGACTGGCTGGCTCGACGAACTCATTTCGAAGCGCCTGACTGCCGAGAGACCCGACACC
ATGCTTGCCGTCGTTTGCGGTGCGACGACAAAGGCGCACGTGGCCAGCGAGGAATGCATAGCTGTCTTTCGCTCG
GGCCTCGAAAAGGGCCAGGTTCCGTCAAAGGAGATTCTCAAGACAGTCTTTCCCATTGACTTTATATACGAGGGC
TACCGCTACAAGTTTACCGCGACTCGTGCTAGCGCTGACAGCTACCACCTCTTTATTAATGGCTCCAAGTGTTCA
GTCGGGGTTCGTGCCCTCTCGGACGGCGGACTGCTGATTCTGCTTGATGGCCACAGTCACAATGCGTATTGGAAG
GAAGAGGTTGGCGCCACACGACTGTCTGTCGATGGCAAGACGTGTCTGCTGGAGCAGGAAAACGACCCCACGCAG
CTTCGGACGCCTAGCCCTGGAAAGCTTGTCAAGTACTCGGTTGAGAATGGCGCCCACGTCAAGGCTGGCCAAGCG
TTTGCCGAAGTCGAAGTCATGAAGATGTACATGCCTCTGGTTGCTCAAGAAGACGGCATTGTCCAGCTCATTAAG
CAGCCCGGCGCAGCGCTGGAGGCGGGCGACATCTTGGGCATTCTCGCTCTCGACGATCCGAGCAGAGTCAAGCAG
GCCCAAGCCTTTGTGGACAAGATTCCAGTATATGGCGACCCTGTTGTTGTGGGCAACAAGCCCGCCCAGCGCTTT
AGCGTGCTGCGAGACATTTTGCTCAACATCTTGATGGGTTATGACAACTCAGTCATCATGGCGCCAACTCTCAAG
GAGCTCATTGAAGTGTTGCGGAGCCCAGAGTTGCCATATAGCGAATGGAATGCCCAGTTCTCGGCTCTTCACGCG
CGCATGCCTCAGAAGCTTGATGCCCAGTTCACACAGGTTGTCGAGCGAGCCAAGTCGCGCCATGTCGAGTTTCCA
GCAAAGACTCTGCAAAAGACTTTTCAAAGGTTTCTTGACGAGAGCGTGGCTGCCAGTGACGCCCAGATGCTCAAG
TCGACGCTGGCTCCGCTGACGGAAATCATTGACACGTATTCCGAAGGCCAAAAGGTGCGGGAGCTCAACTTCATC
AAGAACCTGCTGGATGAGTATTACCAGGTGGAAAAGCTTTTCCTGAGCCAGGCACAAGACGACGGCGTCATTCTC
AAGCTCCGCGACCAGAACAAGGACAATATCAACAAAGTGGTCCAAACAGTGCTTTCACATAGCCGAGTAAGCGCC
AAGAGTTCGCTTGTGTTGGCCATTCTGGAAGAGTACCGGCCAAACAAGCCCAATGTGGGCAATGTTGGCAAGTAC
CTGCGCGACTCGCTGCAGAAGCTTACGGAGCTCTCGTCGCGCGCAACGTCCAAGGTGTCCTTGAAAGCTCGCGAG
ATTATGATTCAGTGTTCTCTGCCCTCGCTGGAGGAGCGTACGGCGCAGATGGAGCATATTCTCCGCTCCTCTGTC
GTTGAGTCGCGGTATGGCGAGAGCGGCTGGGATCACCGCGAACCGAACCTCGATGTGATCAAGGAGGTCGTCGAC
TCCAAGTACACCGTGTTTGACGTGCTGACCCTCTTTTTTGCCCACGAGGATCCCTGGGTGTCGCTGGCATCGCTA
GAGGTTTACATTCGGCGCGCCTACCGTGCCTACACGCTCATGCAAGTCGAGTACCACAATGACGAGACGGACTCT
CCCCAATTTGTGTCTTGGGACTTTCAGCTGCGCAAGATTGGCCAGTCGGAGTTTGGGCTGCCAGTGCAGTCGGCA
GCACCGTCTTCTCCTGGCACGCCCATCAGCTCGGAGGCTGGCATGAAGCGCATCTACTCCATCAGCGACATGTCG
TATCTCACCAATGCATGGGAGGATGAACCGACACGCAAGGGCGTCATTGTGCCCTGCAAGTACCTCGACGAGGCG
GATGAACTGATTCAAAAGGCGCTCGAGACTCTTGCCTTTCACAGCAAGCAAAAGAAGCAGAGCCAGGGCGGCCAA
ATCCTTGCCGATCTCAGTGGCAAGCGCAAGCCACTGAGCGCCGTTAAGCGGGATGCCAAGAAGGACGACGAATTG
TCAGCCGTTATCAACGTGGCAGTGCGCGACGCTGAAAGCAGAGGTGACCAGGAGATGCTGGCGCGTATTTTGCCC
ATTGTCCAACAGTTCAAGACGGAAATGGCAGCGCGCGGCGTGCGACGCTTGACCTTTATCTGCGGCCACAATGAT
GGCTCGTATCCCGGATACTACACGTTTCGCGGTCCGGCATACGAGGAAGATGACAGCATTCGTCACAGCGAGCCA
GCGCTTGCTTTCCAGCTCGAGCTGGCTCGCCTGGGCAAGTTTCACATCAAGCCCGTCTTTACCGAGAACAAGAAC
ATCCACGTGTACGAGGCCATGGGAAAGGCTGTGGACACGGACAAGCGCTACTTTACGCGTGCAGTCATTCGGCCC
GGGCGTCTTCGAGACGAGATTCCCACGGCAGAGTATCTCATTTCCGAAGCGGACCGCGTCATCAATGACATTTTT
GACGCTCTGGAAATCATTGGCAACAACTCGTCCGACTTGAATCACATCTTTATCAACTTTACTCCCGTCTTCCAG
CTGGACCCGCAACAAGTAGAACAGAGTCTTCAGGGATTCCTGGACCGCTTTGGTGCGCGTGGATGGCGGCTCAGG
GTTTCGCAGGTTGAAATTCGCATCATTTGCACCGATCCCCTGACGAGCACTCCCTATCCCCTTCGCGTCGTGGTG
ACGAATACGTCTGGCTACATTGTCGATGTTGACATGTATGCCGAGCGCAAGTCGGAAAAGGGCGAGTGGGTCTTC
CACAGCATTGGCGGTACCAAGGAGAAGGGGCCTATGCACCTGTTGTCTGTATCGACGCCGTATGCGACCAAGAAT
GCTCTCCAGCCAAAACGCTACAAGGCGCATCTCATGGGCACGCAATACGTCTACGACTTTCCCGAGCTCTTTCGC
CAGGCCATTCAAAACTGCTGGGTCAAGGCGGTCAAGAACCGGCCGGCCCTGGCTTCTCAGCAGCCCAAGGTGGGC
GAGTGCATCACGTTTACCGAGCTGGTCCTTGATGATAAGAACAACCTGGACGAAGTGAACCGCGAGCCTGGCACC
AATACCTGCGGCATGGTGGGCTGGATCTTCAAGGCTCGCACGCCCGAATATCCTGCAGGCCGGCGGTTTATTGTG
GTGGCCAATGACATTACCTACAAGATTGGGTCGTTTGGCCCCAAGGAGGACAACTTTTTCAACAAGTGCACTGAG
CTTGCCCGCAAGATTGGCATCCCACGCATCTACCTGTCGGCCAACTCTGGAGCTCGCTTGGGCCTCGCTGAAGAG
CTCATGCCACACTTCAAGGTGGCGTGGAACGACGCCAGCAAGCCAGACAGCGGCTTCCGGTACCTGTATCTGGAC
GACAAGACGCGGCAGAGATTCAAGGATGACGTGATTACCGAAGAGGTTTCAGAAGATGGCGAGAAGCGTCACAAG
ATTGTCACGATTGTGGGGCAGGAAGATGGCCTCGGTGTCGAGTGTCTGAGGGGGTCTGGTCTCATTGCGGGCGCG
ACGAGTCGGGCTTACAACGACATTTTCACGGTGACGCTTGTGACTTGTCGATCTGTCGGTGAGTTGGTTGCATAT
GATGATGATGATGGCGATGAGACTAATGCGACGTTAGGTATCGGGGCGTACCTGGTGCGTCTTGGGCAGCGGGCG
GTGCAAATCGAGGGCCAGCCGATTATTCTGACTGGGGCGCCTGCGCTCAACAACCTGCTTGGGCGAGAAGTTTAC
ACGTCCAATCTGCAGCTGGGAGGCACGCAAATCATGTACCGCAACGGAGTGTCTCACATGACTGCCAATGATGAC
TTTGCTGGTGTCTCAAAGATTGTCGAATGGATGTCATTTGTGCCCGAAAAGCGAAACGGGCCTGTTCCGGTCAGC
CCGAGCGCCGACGAGTGGGACCGCGATGTGACATACTGCCCACCGCAGAGACAGCCATACGACGTCAGGTGGATG
ATTGCCGGCAAGCATGAAGAGGACGGCAGCTTCCAGAGCGGTCTGTTTGACAGGGATTCGTTTGTTGAGACGCTA
GGCGGTTGGGCGCGCACAGTGGTTGTTGGGCGTGCTCGGCTGGGTGGCATCCCCATGGGTGTTATTGCAGTTGAG
ACGCGGTCGATTGAGAACATTATTCCGGCTGACCCTGCCAATCCCGACTCGATTGAGCAAGTGGGCAACGAGGCG
GGAGGCGTCTGGTATCCCAACTCGGCCTTTAAGACGGCACAAGCCATTAATGACTTTAATTATGGCGAACAGCTG
CCGCTCATGATTCTGGCCAACTGGCGCGGGTTTTCGGGCGGCCAGCGCGACATGTTCAACGAGGTGTTGAAGTAT
GGCTCGTATATTGTGGACGCGCTCGTCAAGTTTGAGCAGCCAATCTTTGTCTACATTCCTCCCTTTGGCGAGCTC
CGGGGCGGGTCATGGGTGGTTATTGACCCGACCATCAACGAGACTGCCATGGAGATGTATGCCGACGTTGAGGCG
CGGGGAGGCGTCTTGGAGCCCGAAGGCATCATTGGAATCAAGTATCGCAAAGACAAGCAGCTTGCAACCATGATG
CGCATGGACGCCTTGTACGCGAGCTTGAAGAAGAAGCTTGAGGCCGACGACGTGTCTGCGGAAGAGGCAGCCGAG
GTGAAGAAGCAAATGGCGGATCGGGAGAAGCTGCTGCTGCCCGTGTATGCGCAGATTGCGGTGCAGTTTGCCGAC
TTGCATGACCGGGCTGGGCGCATGAAGGCCAAGGGCACCATTCGCGAGGTGCTGGAGTGGGGGAATGCGCGGCGC
TTCTTTTACTGGCGGCTGCGGCGACGGTTGAATGAAGAGTATATCCTCAAGCGCATGGCGGCGACGCTGATGGCA
CCGTCGTCGAGAGACCAAGGAGCAGGGGGAGCCAAGGCGGGCGAGGTGCGAGCGCGCAACTTGCACCTGCTCGAG
TCGTGGTCGCGCATTGCTGGGTGGGGGGGCAAGGACCGCGAGGTTGCCGAGTGGTACGAGACGGAGCGCAAGGCG
ATTGGCGAAAAGCTCGAGGCGTTCAAGGCGGAGCAGTTGGCTGCCGAGGTGGCGGAAGTGGTGCGCAGCAACAAG
GAGGCTGGGTGGAAGGGAGTGCGCGAGGTGCTTCGGGTAATGCCAGTGGAGGAGCGCGAGGCCATGCTCAAGTTT
TTGAGGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail