Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|72
Gene name
LocationContig_100:5379..6212
Strand+
Gene length (bp)833
Transcript length (bp)627
Coding sequence length (bp)627
Protein length (aa) 209

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01849 NAC NAC domain 8.9E-23 96 151

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H4X9|NACB_CHAGB Nascent polypeptide-associated complex subunit beta OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=EGD1 PE=3 SV=1 92 208 1.0E-70
sp|Q7SDU4|NACB_NEUCR Nascent polypeptide-associated complex subunit beta OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=npc-2 PE=3 SV=2 92 208 3.0E-69
sp|A6R5Z3|NACB_AJECN Nascent polypeptide-associated complex subunit beta OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=EGD1 PE=3 SV=1 92 208 7.0E-69
sp|A1CMP1|NACB_ASPCL Nascent polypeptide-associated complex subunit beta OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=egd1 PE=3 SV=1 92 208 8.0E-68
sp|A1DL98|NACB_NEOFI Nascent polypeptide-associated complex subunit beta OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=egd1 PE=3 SV=1 92 208 1.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H4X9|NACB_CHAGB Nascent polypeptide-associated complex subunit beta OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=EGD1 PE=3 SV=1 92 208 1.0E-70
sp|Q7SDU4|NACB_NEUCR Nascent polypeptide-associated complex subunit beta OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=npc-2 PE=3 SV=2 92 208 3.0E-69
sp|A6R5Z3|NACB_AJECN Nascent polypeptide-associated complex subunit beta OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=EGD1 PE=3 SV=1 92 208 7.0E-69
sp|A1CMP1|NACB_ASPCL Nascent polypeptide-associated complex subunit beta OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=egd1 PE=3 SV=1 92 208 8.0E-68
sp|A1DL98|NACB_NEOFI Nascent polypeptide-associated complex subunit beta OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=egd1 PE=3 SV=1 92 208 1.0E-66
sp|A4RC23|NACB_MAGO7 Nascent polypeptide-associated complex subunit beta OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=EGD1 PE=3 SV=2 92 208 3.0E-66
sp|Q4WCX4|NACB_ASPFU Nascent polypeptide-associated complex subunit beta OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=egd1 PE=3 SV=1 92 208 3.0E-66
sp|A2R091|NACB_ASPNC Nascent polypeptide-associated complex subunit beta OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=egd1 PE=3 SV=1 92 208 2.0E-64
sp|A7F9B8|NACB_SCLS1 Nascent polypeptide-associated complex subunit beta OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=egd1 PE=3 SV=1 92 208 3.0E-63
sp|A6S6B0|NACB_BOTFB Nascent polypeptide-associated complex subunit beta OS=Botryotinia fuckeliana (strain B05.10) GN=egd1 PE=3 SV=1 92 208 3.0E-63
sp|Q0CGL5|NACB_ASPTN Nascent polypeptide-associated complex subunit beta OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=egd1 PE=3 SV=1 92 208 9.0E-63
sp|Q4I283|NACB_GIBZE Nascent polypeptide-associated complex subunit beta OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=EGD1 PE=3 SV=2 92 208 1.0E-61
sp|Q1DI23|NACB_COCIM Nascent polypeptide-associated complex subunit beta OS=Coccidioides immitis (strain RS) GN=EGD1 PE=3 SV=1 92 208 2.0E-61
sp|Q2U6N1|NACB_ASPOR Nascent polypeptide-associated complex subunit beta OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=egd1 PE=3 SV=1 92 208 4.0E-61
sp|Q5ASI4|NACB_EMENI Nascent polypeptide-associated complex subunit beta OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=egd1 PE=3 SV=1 92 208 3.0E-60
sp|Q0ULD0|NACB_PHANO Nascent polypeptide-associated complex subunit beta OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=EGD1 PE=3 SV=1 92 208 9.0E-60
sp|P0CP08|NACB_CRYNJ Nascent polypeptide-associated complex subunit beta OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=EGD1 PE=3 SV=1 92 204 4.0E-43
sp|P0CP09|NACB_CRYNB Nascent polypeptide-associated complex subunit beta OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=EGD1 PE=3 SV=1 92 204 4.0E-43
sp|Q4P9Y9|NACB_USTMA Nascent polypeptide-associated complex subunit beta OS=Ustilago maydis (strain 521 / FGSC 9021) GN=EGD1 PE=3 SV=1 93 183 9.0E-43
sp|Q92371|NACB_SCHPO Nascent polypeptide-associated complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btf3 PE=2 SV=2 91 199 2.0E-36
sp|Q18885|BTF3_CAEEL Transcription factor BTF3 homolog OS=Caenorhabditis elegans GN=icd-1 PE=1 SV=1 92 198 2.0E-34
sp|Q64152|BTF3_MOUSE Transcription factor BTF3 OS=Mus musculus GN=Btf3 PE=1 SV=3 94 208 4.0E-33
sp|P20290|BTF3_HUMAN Transcription factor BTF3 OS=Homo sapiens GN=BTF3 PE=1 SV=1 94 208 5.0E-33
sp|Q6PC91|BT3L4_DANRE Transcription factor BTF3 homolog 4 OS=Danio rerio GN=btf3l4 PE=2 SV=1 94 180 9.0E-32
sp|Q5M8V0|BT3L4_XENTR Transcription factor BTF3 homolog 4 OS=Xenopus tropicalis GN=btf3l4 PE=2 SV=1 94 180 2.0E-31
sp|Q4KLF5|BT3L4_XENLA Transcription factor BTF3 homolog 4 OS=Xenopus laevis GN=btf3l4 PE=2 SV=1 94 180 2.0E-31
sp|Q5ZJG3|BT3L4_CHICK Transcription factor BTF3 homolog 4 OS=Gallus gallus GN=BTF3L4 PE=2 SV=1 94 180 1.0E-30
sp|Q5RC59|BT3L4_PONAB Transcription factor BTF3 homolog 4 OS=Pongo abelii GN=BTF3L4 PE=2 SV=1 94 208 1.0E-30
sp|Q9CQH7|BT3L4_MOUSE Transcription factor BTF3 homolog 4 OS=Mus musculus GN=Btf3l4 PE=1 SV=1 94 208 1.0E-30
sp|Q96K17|BT3L4_HUMAN Transcription factor BTF3 homolog 4 OS=Homo sapiens GN=BTF3L4 PE=1 SV=1 94 208 1.0E-30
sp|Q2KIY7|BT3L4_BOVIN Transcription factor BTF3 homolog 4 OS=Bos taurus GN=BTF3L4 PE=2 SV=1 94 180 1.0E-30
sp|Q6C2F3|NACB_YARLI Nascent polypeptide-associated complex subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EGD1 PE=3 SV=1 95 208 8.0E-26
sp|Q6BLV1|NACB_DEBHA Nascent polypeptide-associated complex subunit beta OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EGD1 PE=3 SV=1 95 204 4.0E-24
sp|A5DF06|NACB_PICGU Nascent polypeptide-associated complex subunit beta OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=EGD1 PE=3 SV=2 92 204 3.0E-21
sp|Q6FKD1|NACB_CANGA Nascent polypeptide-associated complex subunit beta OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=EGD1 PE=3 SV=1 86 208 7.0E-21
sp|A3GHR2|NACB_PICST Nascent polypeptide-associated complex subunit beta OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=EGD1 PE=3 SV=1 95 204 1.0E-20
sp|Q751F1|NACB_ASHGO Nascent polypeptide-associated complex subunit beta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EGD1 PE=3 SV=1 95 208 1.0E-20
sp|Q02642|NACB1_YEAST Nascent polypeptide-associated complex subunit beta-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EGD1 PE=1 SV=2 95 208 3.0E-20
sp|A6ZWL1|NACB1_YEAS7 Nascent polypeptide-associated complex subunit beta-1 OS=Saccharomyces cerevisiae (strain YJM789) GN=EGD1 PE=3 SV=1 95 208 3.0E-20
sp|A5DT59|NACB_LODEL Nascent polypeptide-associated complex subunit beta OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=EGD1 PE=3 SV=1 95 199 3.0E-19
sp|Q54TR8|NACB_DICDI Nascent polypeptide-associated complex subunit beta OS=Dictyostelium discoideum GN=nacB PE=3 SV=1 92 206 8.0E-19
sp|Q59TU0|NACB_CANAL Nascent polypeptide-associated complex subunit beta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EGD1 PE=3 SV=1 95 181 7.0E-17
sp|Q6CR46|NACB_KLULA Nascent polypeptide-associated complex subunit beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EGD1 PE=3 SV=1 99 208 3.0E-15
sp|A6ZYK4|NACB2_YEAS7 Nascent polypeptide-associated complex subunit beta-2 OS=Saccharomyces cerevisiae (strain YJM789) GN=BTT1 PE=3 SV=1 95 184 8.0E-10
sp|P40314|NACB2_YEAST Nascent polypeptide-associated complex subunit beta-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BTT1 PE=1 SV=1 95 184 9.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5463
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|72 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5743
Ophiocordyceps camponoti-floridani Ophcf2|06439
Ophiocordyceps camponoti-rufipedis Ophun1|6096
Ophiocordyceps kimflemingae Ophio5|5981
Ophiocordyceps subramaniannii Hirsu2|6315

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|72
MTCRLVILVFGATSPANLPSRVLPELFEPRRDLANSFAVAAHHVRPSRTSQEARPRGPNWVRNHHLMMYRNDDFM
TPCLATWVADTACADLSGADDKKLQQTLKKLNTQPIQAIEEVNMFKSDGNVIHFAAPKVHAAVPANTFAIYGNGE
DKELTELVPGILNQLGPDSLASLRKLAESYQNMQKGEKGDDDEIPDLVEGENFESKVE*
Coding >OphauG2|72
ATGACTTGCCGCCTTGTAATCCTTGTCTTTGGTGCAACAAGCCCCGCTAATCTGCCGTCTCGCGTCCTGCCAGAG
CTTTTCGAACCTCGCCGTGACTTGGCCAACTCGTTTGCTGTCGCTGCTCATCATGTCCGACCTTCAAGAACGTCT
CAAGAAGCTCGGCCAAGGGGCCCGAATTGGGTACGCAACCACCACTTGATGATGTACCGAAACGATGACTTTATG
ACCCCTTGCTTAGCCACATGGGTTGCTGACACTGCTTGTGCCGATTTGTCCGGTGCCGATGACAAGAAGCTTCAG
CAGACACTCAAGAAGCTCAACACGCAGCCTATTCAAGCTATCGAGGAGGTCAACATGTTCAAGTCGGATGGAAAC
GTGATTCATTTTGCTGCTCCCAAGGTTCACGCGGCGGTGCCCGCAAACACCTTTGCCATTTACGGCAACGGCGAG
GACAAGGAGCTCACGGAGCTTGTTCCAGGGATTCTGAACCAGTTGGGACCCGACTCTCTTGCATCGCTCCGCAAG
CTCGCCGAGAGCTATCAGAATATGCAAAAAGGTGAAAAGGGCGACGACGACGAGATTCCAGATCTAGTCGAGGGT
GAAAACTTTGAAAGCAAAGTCGAGTAG
Transcript >OphauG2|72
ATGACTTGCCGCCTTGTAATCCTTGTCTTTGGTGCAACAAGCCCCGCTAATCTGCCGTCTCGCGTCCTGCCAGAG
CTTTTCGAACCTCGCCGTGACTTGGCCAACTCGTTTGCTGTCGCTGCTCATCATGTCCGACCTTCAAGAACGTCT
CAAGAAGCTCGGCCAAGGGGCCCGAATTGGGTACGCAACCACCACTTGATGATGTACCGAAACGATGACTTTATG
ACCCCTTGCTTAGCCACATGGGTTGCTGACACTGCTTGTGCCGATTTGTCCGGTGCCGATGACAAGAAGCTTCAG
CAGACACTCAAGAAGCTCAACACGCAGCCTATTCAAGCTATCGAGGAGGTCAACATGTTCAAGTCGGATGGAAAC
GTGATTCATTTTGCTGCTCCCAAGGTTCACGCGGCGGTGCCCGCAAACACCTTTGCCATTTACGGCAACGGCGAG
GACAAGGAGCTCACGGAGCTTGTTCCAGGGATTCTGAACCAGTTGGGACCCGACTCTCTTGCATCGCTCCGCAAG
CTCGCCGAGAGCTATCAGAATATGCAAAAAGGTGAAAAGGGCGACGACGACGAGATTCCAGATCTAGTCGAGGGT
GAAAACTTTGAAAGCAAAGTCGAGTAG
Gene >OphauG2|72
ATGACTTGCCGCCTTGTAATCCTTGTCTTTGGTGCAACAAGCCCCGCTAATCTGCCGTCTCGCGTCCTGCCAGAG
CTTTTCGAACCTCGCCGTGACTTGGCCAACTCGTTTGCTGTCGCTGCTCATCATGTCCGACCTTCAAGAACGTCT
CAAGAAGCTCGGCCAAGGGGCCCGAATTGGTGAGCAGGTGTCGTGGCTGCTGGCGAGATGAATGCCTCTTTGTTG
CGCTGACTCATGCGACCTTTTATAGGGTACGCAACCACCACTTGATGATGTACCGAAACGATGACTTTATGACCC
CTTGCTTAGCCACATGGGTTGCTGACACTGCTTGTGCCGATTTGTTACAGAGGAAAGGGTACTCCACGGAGAAAG
GTCAAGCGCGCGCCCGCTAGGTCCGGTGCCGATGACAAGAAGCTTCAGCAGACACTCAAGAAGCTCAACACGCAG
CCTATTCAAGCTATCGAGGAGGTCAACATGTTCAAGTCGGATGGAAACGTGATTCATTTTGCTGCTCCCAAGGGT
AAGGGTCACACCACATGGCTTGGCTGCCCTGGTGAAGAAGAGGAGAAGAAGGAGAGCAACTGACATGGACTCGGT
TTGTAGTTCACGCGGCGGTGCCCGCAAACACCTTTGCCATTTACGGCAACGGCGAGGACAAGGAGCTCACGGAGC
TTGTTCCAGGGATTCTGAACCAGTTGGGACCCGACTCTCTTGCATCGCTCCGCAAGCTCGCCGAGAGCTATCAGA
ATATGCAAAAAGGTGAAAAGGGCGACGACGACGAGATTCCAGATCTAGTCGAGGGTGAAAACTTTGAAAGCAAAG
TCGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail