Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7174
Gene name
LocationContig_806:1445..2680
Strand-
Gene length (bp)1235
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00719 Pyrophosphatase Inorganic pyrophosphatase 3.1E-59 63 245

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6MVH7|IPYR_NEUCR Inorganic pyrophosphatase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ipp-1 PE=3 SV=1 18 304 6.0E-174
sp|Q5B912|IPYR_EMENI Inorganic pyrophosphatase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ipp1 PE=1 SV=2 20 305 3.0E-165
sp|O13505|IPYR_PICPA Inorganic pyrophosphatase OS=Komagataella pastoris GN=IPP1 PE=3 SV=3 20 304 8.0E-154
sp|Q6C1T4|IPYR_YARLI Inorganic pyrophosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPP1 PE=3 SV=1 18 304 3.0E-152
sp|P19117|IPYR_SCHPO Inorganic pyrophosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppa1 PE=3 SV=2 18 303 3.0E-150
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6MVH7|IPYR_NEUCR Inorganic pyrophosphatase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ipp-1 PE=3 SV=1 18 304 6.0E-174
sp|Q5B912|IPYR_EMENI Inorganic pyrophosphatase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ipp1 PE=1 SV=2 20 305 3.0E-165
sp|O13505|IPYR_PICPA Inorganic pyrophosphatase OS=Komagataella pastoris GN=IPP1 PE=3 SV=3 20 304 8.0E-154
sp|Q6C1T4|IPYR_YARLI Inorganic pyrophosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPP1 PE=3 SV=1 18 304 3.0E-152
sp|P19117|IPYR_SCHPO Inorganic pyrophosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppa1 PE=3 SV=2 18 303 3.0E-150
sp|Q6BWA5|IPYR_DEBHA Inorganic pyrophosphatase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPP1 PE=3 SV=1 20 303 3.0E-149
sp|P83777|IPYR_CANAL Inorganic pyrophosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IPP1 PE=1 SV=2 18 303 4.0E-146
sp|P13998|IPYR_KLULA Inorganic pyrophosphatase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPP1 PE=3 SV=2 20 304 2.0E-144
sp|Q757J8|IPYR_ASHGO Inorganic pyrophosphatase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPP1 PE=3 SV=1 20 304 1.0E-142
sp|P00817|IPYR_YEAST Inorganic pyrophosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPP1 PE=1 SV=4 20 303 3.0E-140
sp|Q9C0T9|IPYR_ZYGBA Inorganic pyrophosphatase OS=Zygosaccharomyces bailii GN=IPP1 PE=3 SV=1 20 304 2.0E-138
sp|Q6FRB7|IPYR_CANGA Inorganic pyrophosphatase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPP1 PE=3 SV=1 20 304 2.0E-136
sp|O77460|IPYR_DROME Inorganic pyrophosphatase OS=Drosophila melanogaster GN=Nurf-38 PE=1 SV=3 29 300 2.0E-104
sp|Q9D819|IPYR_MOUSE Inorganic pyrophosphatase OS=Mus musculus GN=Ppa1 PE=1 SV=1 24 298 9.0E-97
sp|Q4R543|IPYR_MACFA Inorganic pyrophosphatase OS=Macaca fascicularis GN=PPA1 PE=2 SV=2 21 298 1.0E-95
sp|P37980|IPYR_BOVIN Inorganic pyrophosphatase OS=Bos taurus GN=PPA1 PE=1 SV=2 24 298 1.0E-95
sp|Q15181|IPYR_HUMAN Inorganic pyrophosphatase OS=Homo sapiens GN=PPA1 PE=1 SV=2 21 298 3.0E-95
sp|Q5R8T6|IPYR_PONAB Inorganic pyrophosphatase OS=Pongo abelii GN=PPA1 PE=2 SV=1 21 298 5.0E-94
sp|Q18680|IPYR_CAEEL Probable inorganic pyrophosphatase 1 OS=Caenorhabditis elegans GN=pyp-1 PE=3 SV=4 4 302 9.0E-94
sp|Q91VM9|IPYR2_MOUSE Inorganic pyrophosphatase 2, mitochondrial OS=Mus musculus GN=Ppa2 PE=1 SV=1 18 300 1.0E-93
sp|Q9H2U2|IPYR2_HUMAN Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens GN=PPA2 PE=1 SV=2 20 300 1.0E-92
sp|Q54PV8|IPYR_DICDI Inorganic pyrophosphatase OS=Dictyostelium discoideum GN=ppa1 PE=1 SV=1 20 274 3.0E-91
sp|P87118|IPYR2_SCHPO Putative inorganic pyrophosphatase C3A12.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A12.02 PE=3 SV=1 28 245 8.0E-89
sp|P28239|IPYR2_YEAST Inorganic pyrophosphatase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPA2 PE=1 SV=1 45 300 1.0E-81
sp|Q8SR69|IPYR_ENCCU Inorganic pyrophosphatase OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPP1 PE=1 SV=1 20 286 9.0E-81
sp|Q93Y52|IPYR1_CHLRE Soluble inorganic pyrophosphatase 1, chloroplastic OS=Chlamydomonas reinhardtii GN=ppa1 PE=1 SV=1 1 250 3.0E-67
sp|Q9LXC9|IPYR6_ARATH Soluble inorganic pyrophosphatase 6, chloroplastic OS=Arabidopsis thaliana GN=PPA6 PE=1 SV=1 26 259 4.0E-66
sp|O77392|IPYR_PLAF7 Probable inorganic pyrophosphatase OS=Plasmodium falciparum (isolate 3D7) GN=MAL3P6.3 PE=3 SV=1 36 244 5.0E-39
sp|O48556|IPYR_MAIZE Soluble inorganic pyrophosphatase OS=Zea mays GN=IPP PE=2 SV=1 13 236 8.0E-12
sp|Q93V56|IPYR1_ARATH Soluble inorganic pyrophosphatase 1 OS=Arabidopsis thaliana GN=PPA1 PE=1 SV=1 13 211 9.0E-12
sp|Q72MG4|IPYR_LEPIC Inorganic pyrophosphatase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=ppa PE=3 SV=1 44 246 2.0E-11
sp|Q0DYB1|IPYR_ORYSJ Soluble inorganic pyrophosphatase OS=Oryza sativa subsp. japonica GN=IPP PE=2 SV=1 12 236 2.0E-11
sp|A2X8Q3|IPYR_ORYSI Soluble inorganic pyrophosphatase OS=Oryza sativa subsp. indica GN=IPP PE=2 SV=1 12 236 2.0E-11
sp|Q8EZ21|IPYR_LEPIN Inorganic pyrophosphatase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=ppa PE=3 SV=1 44 246 2.0E-11
sp|Q9LFF9|IPYR4_ARATH Soluble inorganic pyrophosphatase 4 OS=Arabidopsis thaliana GN=PPA4 PE=1 SV=1 10 211 2.0E-10
sp|O82793|IPYR3_ARATH Soluble inorganic pyrophosphatase 3 OS=Arabidopsis thaliana GN=PPA3 PE=2 SV=1 15 211 3.0E-10
sp|P50308|IPYR_SULAC Inorganic pyrophosphatase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=ppa PE=1 SV=1 60 192 4.0E-10
sp|Q9UY24|IPYR_PYRAB Inorganic pyrophosphatase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ppa PE=3 SV=1 44 216 8.0E-10
sp|O82597|IPYR5_ARATH Soluble inorganic pyrophosphatase 5 OS=Arabidopsis thaliana GN=PPA5 PE=2 SV=1 37 239 9.0E-10
sp|P77992|IPYR_THELN Inorganic pyrophosphatase OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=ppa PE=3 SV=1 44 216 1.0E-09
sp|P21216|IPYR2_ARATH Soluble inorganic pyrophosphatase 2 OS=Arabidopsis thaliana GN=PPA2 PE=2 SV=2 46 250 2.0E-09
sp|Q5JIY3|IPYR_THEKO Inorganic pyrophosphatase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=ppa PE=3 SV=1 44 216 2.0E-09
sp|Q43187|IPYR_SOLTU Soluble inorganic pyrophosphatase OS=Solanum tuberosum GN=PPA PE=2 SV=1 23 239 2.0E-09
sp|P56153|IPYR_HELPY Inorganic pyrophosphatase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ppa PE=1 SV=1 52 245 3.0E-09
sp|Q8TVE2|IPYR_METKA Inorganic pyrophosphatase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=ppa PE=3 SV=1 60 225 3.0E-09
sp|O59570|IPYR_PYRHO Inorganic pyrophosphatase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ppa PE=1 SV=1 44 216 5.0E-09
sp|O23979|IPYR_HORVD Soluble inorganic pyrophosphatase OS=Hordeum vulgare var. distichum GN=IPP PE=2 SV=1 6 181 5.0E-09
sp|Q97W51|IPYR_SULSO Inorganic pyrophosphatase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=ppa PE=3 SV=1 61 211 5.0E-09
sp|Q9ZLL5|IPYR_HELPJ Inorganic pyrophosphatase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ppa PE=3 SV=1 52 245 5.0E-09
sp|Q74MY6|IPYR_NANEQ Inorganic pyrophosphatase OS=Nanoarchaeum equitans (strain Kin4-M) GN=ppa PE=3 SV=1 65 246 6.0E-09
sp|Q6KZB3|IPYR_PICTO Inorganic pyrophosphatase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=ppa PE=3 SV=1 63 211 1.0E-08
sp|Q8U438|IPYR_PYRFU Inorganic pyrophosphatase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=ppa PE=1 SV=1 44 216 1.0E-08
sp|P37981|IPYR_THEAC Inorganic pyrophosphatase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=ppa PE=1 SV=1 63 226 3.0E-08
sp|Q949J1|IPYR2_CHLRE Soluble inorganic pyrophosphatase 2 OS=Chlamydomonas reinhardtii GN=ppa2 PE=1 SV=1 41 244 2.0E-07
sp|Q9KCG7|IPYR_BACHD Inorganic pyrophosphatase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ppa PE=3 SV=1 60 245 6.0E-07
sp|P80507|IPYR_SYNY3 Inorganic pyrophosphatase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ppa PE=1 SV=2 57 211 1.0E-06
sp|Q8DHR2|IPYR_THEEB Inorganic pyrophosphatase OS=Thermosynechococcus elongatus (strain BP-1) GN=ppa PE=3 SV=2 57 211 2.0E-06
sp|Q8EVW9|IPYR_MYCPE Inorganic pyrophosphatase OS=Mycoplasma penetrans (strain HF-2) GN=ppa PE=3 SV=1 61 246 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004427 inorganic diphosphatase activity Yes
GO:0006796 phosphate-containing compound metabolic process Yes
GO:0005737 cytoplasm Yes
GO:0000287 magnesium ion binding Yes
GO:0005575 cellular_component No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0006793 phosphorus metabolic process No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016787 hydrolase activity No
GO:0009987 cellular process No
GO:0016462 pyrophosphatase activity No
GO:0005488 binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0044237 cellular metabolic process No
GO:0043169 cation binding No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2723
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7174 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2113
Ophiocordyceps camponoti-floridani Ophcf2|00331
Ophiocordyceps camponoti-rufipedis Ophun1|3507
Ophiocordyceps kimflemingae Ophio5|6946
Ophiocordyceps subramaniannii Hirsu2|4279

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7174
MASAQSPSNPPGAASSKSPYTLRRVAPLNTQKHRVYLEKDGVPISPFHDIPLYVNEKQGILNMVVEIPRWTNAKL
EISKEELLNPIKQDIKNGKLRYVRNCFPHKGYLWNYGAFPKTWEDPNVVHPETKAKGDNDPLDVCEIGESVGYTG
QVKQVKVLGVMALLDEEETDWKVIVIDVNDPIAHKLNDIEDVERHLPGLIRATNEWFRIYKIPDGKPENQFAFTG
ECKNKKYAMDVIRECAEAWERLITGKTSPGSVSIANTTVAHSPNRIAPDQLPNLPADENLPPEKIDGSIDKWFFI
SGAST*
Coding >OphauG2|7174
ATGGCTTCGGCGCAGTCGCCTTCGAATCCTCCTGGCGCGGCATCTTCAAAGTCGCCTTATACTCTTCGCAGGGTG
GCACCCCTCAATACACAGAAGCACCGTGTCTACCTTGAGAAGGATGGCGTTCCAATCTCGCCCTTTCACGACATT
CCCCTCTATGTAAACGAGAAGCAGGGCATTCTAAACATGGTTGTTGAGATTCCTCGATGGACAAACGCTAAGCTT
GAGATTTCCAAGGAGGAACTGCTCAACCCCATCAAGCAGGACATCAAAAACGGCAAACTTCGCTATGTTCGCAAC
TGCTTCCCACACAAGGGTTATCTCTGGAACTACGGCGCTTTCCCCAAGACCTGGGAGGACCCTAATGTGGTTCAC
CCCGAAACCAAAGCTAAGGGCGACAATGACCCTCTTGACGTTTGTGAAATCGGCGAGTCTGTCGGTTATACCGGA
CAAGTCAAGCAGGTCAAGGTACTCGGCGTCATGGCCCTCCTAGACGAAGAGGAAACGGACTGGAAAGTCATCGTC
ATTGATGTCAATGACCCCATTGCACACAAGCTCAATGACATTGAGGACGTTGAGCGCCACTTGCCAGGTCTCATT
CGAGCCACTAACGAGTGGTTTCGAATCTACAAGATTCCTGATGGCAAACCCGAGAACCAGTTTGCATTCACGGGT
GAATGCAAGAACAAAAAGTACGCCATGGACGTCATCCGCGAGTGTGCAGAGGCTTGGGAACGCCTCATTACTGGC
AAGACCTCTCCAGGCAGCGTATCTATCGCAAACACGACTGTCGCCCACTCTCCCAACCGTATAGCCCCCGATCAG
CTTCCCAATCTGCCTGCCGACGAGAATCTTCCTCCCGAGAAGATTGACGGTTCCATTGACAAGTGGTTCTTCATT
AGCGGCGCCTCCACCTAG
Transcript >OphauG2|7174
ATGGCTTCGGCGCAGTCGCCTTCGAATCCTCCTGGCGCGGCATCTTCAAAGTCGCCTTATACTCTTCGCAGGGTG
GCACCCCTCAATACACAGAAGCACCGTGTCTACCTTGAGAAGGATGGCGTTCCAATCTCGCCCTTTCACGACATT
CCCCTCTATGTAAACGAGAAGCAGGGCATTCTAAACATGGTTGTTGAGATTCCTCGATGGACAAACGCTAAGCTT
GAGATTTCCAAGGAGGAACTGCTCAACCCCATCAAGCAGGACATCAAAAACGGCAAACTTCGCTATGTTCGCAAC
TGCTTCCCACACAAGGGTTATCTCTGGAACTACGGCGCTTTCCCCAAGACCTGGGAGGACCCTAATGTGGTTCAC
CCCGAAACCAAAGCTAAGGGCGACAATGACCCTCTTGACGTTTGTGAAATCGGCGAGTCTGTCGGTTATACCGGA
CAAGTCAAGCAGGTCAAGGTACTCGGCGTCATGGCCCTCCTAGACGAAGAGGAAACGGACTGGAAAGTCATCGTC
ATTGATGTCAATGACCCCATTGCACACAAGCTCAATGACATTGAGGACGTTGAGCGCCACTTGCCAGGTCTCATT
CGAGCCACTAACGAGTGGTTTCGAATCTACAAGATTCCTGATGGCAAACCCGAGAACCAGTTTGCATTCACGGGT
GAATGCAAGAACAAAAAGTACGCCATGGACGTCATCCGCGAGTGTGCAGAGGCTTGGGAACGCCTCATTACTGGC
AAGACCTCTCCAGGCAGCGTATCTATCGCAAACACGACTGTCGCCCACTCTCCCAACCGTATAGCCCCCGATCAG
CTTCCCAATCTGCCTGCCGACGAGAATCTTCCTCCCGAGAAGATTGACGGTTCCATTGACAAGTGGTTCTTCATT
AGCGGCGCCTCCACCTAG
Gene >OphauG2|7174
ATGGCTTCGGCGCAGTCGCCTTCGAATCCTCCTGGCGCGGCATCTTCAAAGTCGCCTTATACTCTTCGCAGGGTG
GCACCCCTCAATACACAGAAGCACCGTGTCTACCTTGAGAAGGATGGCGTTCCAATCTCGCCCTTTCACGACATT
CCCCTCTATGTAAACGAGAAGCAGGGCATTCTAAACATGGTTGTTGAGATTCCTCGATGGACAAACGCTAAGCTT
GAGGTATGGCACCCCGCCATCTATTTTGCCCATGGCCCCATCTCGTGCACGCTTCACCAAGCTTGCAAATCGCTC
AAGGCGCTCCAATTGGCCTCTATAACATTGTAACCGCTAACAATTTTTGTCCCCTTCAGATTTCCAAGGAGGAAC
TGCTCAACCCCATCAAGCAGGACATCAAAAACGGCAAACTTCGCTATGTTCGCAACTGCTTCCCACACAAGGGTT
ATCTCTGGAACTACGGCGCTTTCCCCAAGGTATGCCACCCGCGTCACCACTTGTTGACCAATCCTCGTTTGATCT
CTACTAACAGTCGATGCAAACAAAAGACCTGGGAGGACCCTAATGTGGTTCACCCCGAAACCAAAGCTAAGGGCG
ACAATGACCCTCTTGACGTTTGTGAAATCGGCGAGTCTGTCGGTTATACCGGACAAGTCAAGCAGGTCAAGGTAC
TCGGCGTCATGGCCCTCCTAGACGAAGAGGAAACGGACTGGAAAGTCATCGTCATTGATGTCAATGACCCCATTG
CACACAAGCTCAATGACATTGAGGACGTTGAGCGCCACTTGCCAGGTCTCATTCGAGCCACTAACGAGTGGTTTC
GAATCTACAAGATTCCTGATGGCAAACCCGAGAACCAGTTTGCATTCACGGGTGAATGCAAGAACAAAAAGTCGG
TTCCCCTTGACGCATCTGCTGTTTGAGCATTCTTGACGCTGACATGTCTGCTAGGTACGCCATGGACGTCATCCG
CGAGTGTGCAGAGGCTTGGGAACGCCTCATTACTGGCAAGACCTCTCCAGGCAGCGTATCTATGTAAGTACAGCT
TTTTTGACAGTACTGCAAAAGCTTTTCGACTAATGGAATCTAGCGCAAACACGACTGTCGCCCACTCTCCCAACC
GTATAGCCCCCGATCAGCTTCCCAATCTGCCTGCCGACGAGAATCTTCCTCCCGAGAAGATTGACGGTTCCATTG
ACAAGTGGTTCTTCATTAGCGGCGCCTCCACCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail