Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7167
Gene name
LocationContig_804:5117..5675
Strand-
Gene length (bp)558
Transcript length (bp)558
Coding sequence length (bp)558
Protein length (aa) 186

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01912 eIF-6 eIF-6 family 7.7E-59 1 142

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C9SV08|IF6_VERA1 Eukaryotic translation initiation factor 6 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=TIF6 PE=3 SV=2 1 185 1.0E-125
sp|Q7S2W6|IF6_NEUCR Eukaryotic translation initiation factor 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tif-6 PE=3 SV=1 1 185 4.0E-120
sp|D1ZG64|IF6_SORMK Eukaryotic translation initiation factor 6 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=TIF6 PE=3 SV=2 1 185 6.0E-120
sp|Q2UTN7|IF6_ASPOR Eukaryotic translation initiation factor 6 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tif6 PE=3 SV=2 1 185 6.0E-111
sp|Q5ASA6|IF6_EMENI Eukaryotic translation initiation factor 6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tif6 PE=3 SV=1 1 185 8.0E-110
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C9SV08|IF6_VERA1 Eukaryotic translation initiation factor 6 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=TIF6 PE=3 SV=2 1 185 1.0E-125
sp|Q7S2W6|IF6_NEUCR Eukaryotic translation initiation factor 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tif-6 PE=3 SV=1 1 185 4.0E-120
sp|D1ZG64|IF6_SORMK Eukaryotic translation initiation factor 6 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=TIF6 PE=3 SV=2 1 185 6.0E-120
sp|Q2UTN7|IF6_ASPOR Eukaryotic translation initiation factor 6 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tif6 PE=3 SV=2 1 185 6.0E-111
sp|Q5ASA6|IF6_EMENI Eukaryotic translation initiation factor 6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tif6 PE=3 SV=1 1 185 8.0E-110
sp|B8MDN4|IF6_TALSN Eukaryotic translation initiation factor 6 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=tif6 PE=3 SV=1 1 185 1.0E-108
sp|Q12522|IF6_YEAST Eukaryotic translation initiation factor 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF6 PE=1 SV=1 1 184 1.0E-101
sp|Q59L13|IF6_CANAL Eukaryotic translation initiation factor 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIF6 PE=3 SV=1 1 184 4.0E-101
sp|Q6ZM19|IF6_DANRE Eukaryotic translation initiation factor 6 OS=Danio rerio GN=eif6 PE=2 SV=1 1 184 7.0E-99
sp|Q6GR45|IF6_XENLA Eukaryotic translation initiation factor 6 OS=Xenopus laevis GN=eif6 PE=2 SV=1 1 184 2.0E-98
sp|O55135|IF6_MOUSE Eukaryotic translation initiation factor 6 OS=Mus musculus GN=Eif6 PE=1 SV=2 1 184 3.0E-97
sp|Q3KRD8|IF6_RAT Eukaryotic translation initiation factor 6 OS=Rattus norvegicus GN=Eif6 PE=1 SV=1 1 184 3.0E-97
sp|P56537|IF6_HUMAN Eukaryotic translation initiation factor 6 OS=Homo sapiens GN=EIF6 PE=1 SV=1 1 184 7.0E-97
sp|Q9TU47|IF6_BOVIN Eukaryotic translation initiation factor 6 OS=Bos taurus GN=EIF6 PE=2 SV=2 1 184 1.0E-96
sp|P56538|IF6_DROME Eukaryotic translation initiation factor 6 OS=Drosophila melanogaster GN=eIF6 PE=2 SV=3 1 182 3.0E-95
sp|O94476|IF6_SCHPO Eukaryotic translation initiation factor 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif6 PE=3 SV=1 1 184 5.0E-95
sp|Q9M060|IF62_ARATH Eukaryotic translation initiation factor 6-2 OS=Arabidopsis thaliana GN=EIF6-2 PE=2 SV=1 1 184 4.0E-88
sp|Q551M2|IF6_DICDI Eukaryotic translation initiation factor 6 OS=Dictyostelium discoideum GN=eif6 PE=1 SV=1 1 169 7.0E-86
sp|A4RSQ6|IF6_OSTLU Eukaryotic translation initiation factor 6 OS=Ostreococcus lucimarinus (strain CCE9901) GN=EIF6 PE=3 SV=2 1 181 2.0E-83
sp|Q245F2|IF6_TETTS Eukaryotic translation initiation factor 6 OS=Tetrahymena thermophila (strain SB210) GN=EIF6 PE=1 SV=1 1 178 3.0E-79
sp|O62106|IF6_CAEEL Eukaryotic translation initiation factor 6 OS=Caenorhabditis elegans GN=eif-6 PE=3 SV=1 1 184 6.0E-78
sp|Q4E097|IF61_TRYCC Eukaryotic translation initiation factor 6 OS=Trypanosoma cruzi (strain CL Brener) GN=EIF6 PE=3 SV=2 1 184 2.0E-76
sp|B9PVB9|IF6_TOXGO Eukaryotic translation initiation factor 6 OS=Toxoplasma gondii GN=EIF6 PE=3 SV=3 1 164 4.0E-75
sp|O22290|IF61_ARATH Eukaryotic translation initiation factor 6-1 OS=Arabidopsis thaliana GN=EIF6-1 PE=2 SV=1 1 184 5.0E-75
sp|B0EMY3|IF6_ENTDS Eukaryotic translation initiation factor 6 OS=Entamoeba dispar (strain ATCC PRA-260 / SAW760) GN=EIF6 PE=3 SV=2 1 163 8.0E-75
sp|A7ANL7|IF6_BABBO Eukaryotic translation initiation factor 6 OS=Babesia bovis GN=EIF6 PE=3 SV=2 1 184 1.0E-72
sp|O81920|IF6_BETVU Eukaryotic translation initiation factor 6 (Fragment) OS=Beta vulgaris PE=2 SV=1 5 132 3.0E-65
sp|Q8SS47|IF6_ENCCU Eukaryotic translation initiation factor 6 OS=Encephalitozoon cuniculi (strain GB-M1) GN=TIF6 PE=3 SV=2 4 163 2.0E-62
sp|Q98RM8|IF6_GUITH Eukaryotic translation initiation factor 6 OS=Guillardia theta GN=EIF6 PE=3 SV=1 1 162 5.0E-39
sp|Q9XYP3|IF6_TRYCR Eukaryotic translation initiation factor 6 (Fragment) OS=Trypanosoma cruzi PE=3 SV=1 77 184 6.0E-36
sp|Q9YD27|IF6_AERPE Translation initiation factor 6 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=eif6 PE=3 SV=1 1 158 2.0E-28
sp|Q2NGQ7|IF6_METST Translation initiation factor 6 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=eif6 PE=3 SV=1 1 167 4.0E-28
sp|A2BN57|IF6_HYPBU Translation initiation factor 6 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=eif6 PE=3 SV=1 1 163 1.0E-27
sp|Q8PYQ3|IF6_METMA Translation initiation factor 6 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=eif6 PE=3 SV=1 1 158 4.0E-26
sp|Q8U3S8|IF6_PYRFU Translation initiation factor 6 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=eif6 PE=3 SV=1 1 158 1.0E-25
sp|C5A7H2|IF6_THEGJ Translation initiation factor 6 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=eif6 PE=3 SV=1 1 158 2.0E-25
sp|B6YWY2|IF6_THEON Translation initiation factor 6 OS=Thermococcus onnurineus (strain NA1) GN=eif6 PE=3 SV=1 1 158 5.0E-25
sp|A7I9I6|IF6_METB6 Translation initiation factor 6 OS=Methanoregula boonei (strain 6A8) GN=eif6 PE=3 SV=1 1 161 8.0E-25
sp|C3N7D3|IF6_SULIY Translation initiation factor 6 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=eif6 PE=3 SV=1 1 165 4.0E-24
sp|C3NGA1|IF6_SULIN Translation initiation factor 6 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=eif6 PE=3 SV=1 1 165 4.0E-24
sp|C3MR78|IF6_SULIL Translation initiation factor 6 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=eif6 PE=3 SV=1 1 165 4.0E-24
sp|Q8TUY5|IF6_METKA Translation initiation factor 6 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=eif6 PE=3 SV=1 1 163 5.0E-24
sp|C4KIJ1|IF6_SULIK Translation initiation factor 6 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=eif6 PE=3 SV=1 1 165 6.0E-24
sp|C3MXG7|IF6_SULIM Translation initiation factor 6 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=eif6 PE=3 SV=1 1 165 6.0E-24
sp|C3MZB3|IF6_SULIA Translation initiation factor 6 OS=Sulfolobus islandicus (strain M.16.27) GN=eif6 PE=3 SV=1 1 165 6.0E-24
sp|Q980G0|IF6_SULSO Translation initiation factor 6 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=eif6 PE=1 SV=1 1 165 2.0E-23
sp|Q5JGT4|IF6_THEKO Translation initiation factor 6 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=eif6 PE=3 SV=1 1 158 4.0E-23
sp|Q46FA1|IF6_METBF Translation initiation factor 6 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=eif6 PE=3 SV=1 1 158 5.0E-23
sp|Q60357|IF6_METJA Translation initiation factor 6 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=eif6 PE=1 SV=1 1 163 9.0E-23
sp|Q9UYI6|IF6_PYRAB Translation initiation factor 6 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=eif6 PE=3 SV=1 1 163 3.0E-22
sp|Q8ZTU1|IF6_PYRAE Translation initiation factor 6 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=eif6 PE=3 SV=1 1 161 5.0E-22
sp|O58264|IF6_PYRHO Translation initiation factor 6 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=eif6 PE=3 SV=1 1 158 7.0E-22
sp|A9A305|IF6_NITMS Translation initiation factor 6 OS=Nitrosopumilus maritimus (strain SCM1) GN=eif6 PE=3 SV=1 5 161 9.0E-22
sp|Q8TIN4|IF6_METAC Translation initiation factor 6 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=eif6 PE=3 SV=1 1 158 1.0E-21
sp|A4WL95|IF6_PYRAR Translation initiation factor 6 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=eif6 PE=3 SV=1 1 161 2.0E-21
sp|Q18EU8|IF6_HALWD Translation initiation factor 6 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=eif6 PE=3 SV=1 1 158 4.0E-20
sp|Q12ZJ5|IF6_METBU Translation initiation factor 6 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=eif6 PE=3 SV=1 1 158 7.0E-20
sp|B8GEU6|IF6_METPE Translation initiation factor 6 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=eif6 PE=3 SV=1 1 166 7.0E-20
sp|Q3ITD5|IF6_NATPD Translation initiation factor 6 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=eif6 PE=3 SV=1 1 161 8.0E-20
sp|A3CWZ4|IF6_METMJ Translation initiation factor 6 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=eif6 PE=3 SV=1 1 161 1.0E-19
sp|B9LUU8|IF6_HALLT Translation initiation factor 6 OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=eif6 PE=3 SV=1 1 161 2.0E-19
sp|Q2FS97|IF6_METHJ Translation initiation factor 6 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=eif6 PE=3 SV=1 4 165 2.0E-19
sp|Q971I4|IF6_SULTO Translation initiation factor 6 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=eif6 PE=3 SV=1 1 161 5.0E-19
sp|A0RYC3|IF6_CENSY Translation initiation factor 6 OS=Cenarchaeum symbiosum (strain A) GN=eif6 PE=3 SV=1 5 161 6.0E-19
sp|Q0W5H2|IF6_METAR Translation initiation factor 6 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=eif6 PE=3 SV=1 1 158 7.0E-19
sp|Q9HM16|IF6_THEAC Translation initiation factor 6 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=eif6 PE=3 SV=2 1 161 1.0E-18
sp|A2STI7|IF6_METLZ Translation initiation factor 6 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=eif6 PE=3 SV=1 4 161 1.0E-17
sp|O27648|IF6_METTH Translation initiation factor 6 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=eif6 PE=1 SV=1 1 166 2.0E-17
sp|P38619|IF6_SULAC Translation initiation factor 6 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=eif6 PE=3 SV=2 1 161 2.0E-17
sp|O28214|IF6_ARCFU Translation initiation factor 6 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=eif6 PE=3 SV=1 1 158 3.0E-17
sp|Q97CU0|IF6_THEVO Translation initiation factor 6 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=eif6 PE=3 SV=1 1 161 4.0E-17
sp|A9A8N1|IF6_METM6 Translation initiation factor 6 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=eif6 PE=3 SV=1 1 163 1.0E-16
sp|Q6M156|IF6_METMP Translation initiation factor 6 OS=Methanococcus maripaludis (strain S2 / LL) GN=eif6 PE=3 SV=1 1 163 1.0E-16
sp|A1RXF3|IF6_THEPD Translation initiation factor 6 OS=Thermofilum pendens (strain Hrk 5) GN=eif6 PE=3 SV=1 3 161 2.0E-16
sp|A6UR54|IF6_METVS Translation initiation factor 6 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=eif6 PE=3 SV=1 1 163 2.0E-16
sp|A6VI48|IF6_METM7 Translation initiation factor 6 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=eif6 PE=3 SV=1 1 163 3.0E-16
sp|Q6L2L0|IF6_PICTO Translation initiation factor 6 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=eif6 PE=3 SV=1 1 158 5.0E-16
sp|A3DNH5|IF6_STAMF Translation initiation factor 6 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=eif6 PE=3 SV=1 1 154 5.0E-16
sp|A4G0C9|IF6_METM5 Translation initiation factor 6 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=eif6 PE=3 SV=1 1 163 8.0E-16
sp|A6UT95|IF6_META3 Translation initiation factor 6 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=eif6 PE=3 SV=1 1 158 1.0E-13
sp|B0R7X7|IF6_HALS3 Translation initiation factor 6 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=eif6 PE=3 SV=1 1 158 1.0E-10
sp|A5UL31|IF6_METS3 Translation initiation factor 6 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=eif6 PE=3 SV=1 1 158 6.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0043022 ribosome binding Yes
GO:0042256 mature ribosome assembly Yes
GO:0043021 ribonucleoprotein complex binding No
GO:0003674 molecular_function No
GO:0016043 cellular component organization No
GO:0070925 organelle assembly No
GO:0042255 ribosome assembly No
GO:0005488 binding No
GO:0071840 cellular component organization or biogenesis No
GO:0006996 organelle organization No
GO:0008150 biological_process No
GO:0022607 cellular component assembly No
GO:0140694 non-membrane-bounded organelle assembly No
GO:0044877 protein-containing complex binding No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5030
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7167 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6923
Ophiocordyceps camponoti-floridani Ophcf2|01863
Ophiocordyceps camponoti-rufipedis Ophun1|6719
Ophiocordyceps kimflemingae Ophio5|8228
Ophiocordyceps subramaniannii Hirsu2|2594

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7167
MTAGNRKGLLVPTTTTDQELQHLRNSLPDAVRIQRIEERLSALGNVIATNDHIALVHPDLERETEEIIADVLGVE
VFRQTIADNVLVGSYMSLSNQGGLVHPKTSIQDQDELSSLLQVPLVAGSVNRGSNVVGGGMVVNDWLAVTGLDTT
ATELSVIESVFRLGEGSGPSNINTTMKDTMVESFY*
Coding >OphauG2|7167
ATGACGGCGGGAAATCGCAAGGGCCTCTTGGTACCGACGACGACGACGGATCAAGAATTGCAACACCTGCGCAAC
TCGCTGCCAGACGCGGTGCGCATCCAACGCATTGAGGAACGCCTATCCGCTCTGGGCAACGTGATTGCCACTAAT
GACCATATTGCCCTTGTTCACCCCGATCTGGAACGCGAGACGGAGGAGATTATTGCTGATGTGCTCGGCGTCGAG
GTCTTTCGCCAGACTATTGCCGACAATGTGCTTGTTGGAAGCTACATGAGCCTCTCCAACCAGGGAGGCCTGGTA
CATCCCAAGACGAGCATTCAGGACCAGGACGAACTGTCAAGTTTGCTGCAGGTGCCCCTGGTAGCCGGCAGCGTT
AACCGGGGGAGCAATGTTGTTGGCGGTGGCATGGTTGTCAACGACTGGCTGGCTGTGACAGGCCTGGACACGACG
GCAACCGAGCTGAGTGTTATTGAGAGTGTCTTTCGCCTAGGCGAAGGCTCTGGACCCAGCAACATCAACACCACC
ATGAAGGACACCATGGTGGAGAGCTTCTACTAG
Transcript >OphauG2|7167
ATGACGGCGGGAAATCGCAAGGGCCTCTTGGTACCGACGACGACGACGGATCAAGAATTGCAACACCTGCGCAAC
TCGCTGCCAGACGCGGTGCGCATCCAACGCATTGAGGAACGCCTATCCGCTCTGGGCAACGTGATTGCCACTAAT
GACCATATTGCCCTTGTTCACCCCGATCTGGAACGCGAGACGGAGGAGATTATTGCTGATGTGCTCGGCGTCGAG
GTCTTTCGCCAGACTATTGCCGACAATGTGCTTGTTGGAAGCTACATGAGCCTCTCCAACCAGGGAGGCCTGGTA
CATCCCAAGACGAGCATTCAGGACCAGGACGAACTGTCAAGTTTGCTGCAGGTGCCCCTGGTAGCCGGCAGCGTT
AACCGGGGGAGCAATGTTGTTGGCGGTGGCATGGTTGTCAACGACTGGCTGGCTGTGACAGGCCTGGACACGACG
GCAACCGAGCTGAGTGTTATTGAGAGTGTCTTTCGCCTAGGCGAAGGCTCTGGACCCAGCAACATCAACACCACC
ATGAAGGACACCATGGTGGAGAGCTTCTACTAG
Gene >OphauG2|7167
ATGACGGCGGGAAATCGCAAGGGCCTCTTGGTACCGACGACGACGACGGATCAAGAATTGCAACACCTGCGCAAC
TCGCTGCCAGACGCGGTGCGCATCCAACGCATTGAGGAACGCCTATCCGCTCTGGGCAACGTGATTGCCACTAAT
GACCATATTGCCCTTGTTCACCCCGATCTGGAACGCGAGACGGAGGAGATTATTGCTGATGTGCTCGGCGTCGAG
GTCTTTCGCCAGACTATTGCCGACAATGTGCTTGTTGGAAGCTACATGAGCCTCTCCAACCAGGGAGGCCTGGTA
CATCCCAAGACGAGCATTCAGGACCAGGACGAACTGTCAAGTTTGCTGCAGGTGCCCCTGGTAGCCGGCAGCGTT
AACCGGGGGAGCAATGTTGTTGGCGGTGGCATGGTTGTCAACGACTGGCTGGCTGTGACAGGCCTGGACACGACG
GCAACCGAGCTGAGTGTTATTGAGAGTGTCTTTCGCCTAGGCGAAGGCTCTGGACCCAGCAACATCAACACCACC
ATGAAGGACACCATGGTGGAGAGCTTCTACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail