Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7165
Gene name
LocationContig_804:785..3109
Strand+
Gene length (bp)2324
Transcript length (bp)1962
Coding sequence length (bp)1962
Protein length (aa) 654

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13646 HEAT_2 HEAT repeats 9.8E-12 387 487

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT08|2AAA_SCHPO Protein phosphatase PP2A regulatory subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=paa1 PE=3 SV=1 6 626 0.0E+00
sp|P36179|2AAA_DROME Serine/threonine-protein phosphatase PP2A 65 kDa regulatory subunit OS=Drosophila melanogaster GN=Pp2A-29B PE=2 SV=4 2 622 0.0E+00
sp|Q38950|2AAB_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Arabidopsis thaliana GN=PP2AA2 PE=1 SV=2 8 626 0.0E+00
sp|Q38845|2AAA_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Arabidopsis thaliana GN=PP2AA1 PE=1 SV=1 1 632 0.0E+00
sp|Q38951|2AAG_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A gamma isoform OS=Arabidopsis thaliana GN=PP2AA3 PE=1 SV=2 1 626 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT08|2AAA_SCHPO Protein phosphatase PP2A regulatory subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=paa1 PE=3 SV=1 6 626 0.0E+00
sp|P36179|2AAA_DROME Serine/threonine-protein phosphatase PP2A 65 kDa regulatory subunit OS=Drosophila melanogaster GN=Pp2A-29B PE=2 SV=4 2 622 0.0E+00
sp|Q38950|2AAB_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Arabidopsis thaliana GN=PP2AA2 PE=1 SV=2 8 626 0.0E+00
sp|Q38845|2AAA_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Arabidopsis thaliana GN=PP2AA1 PE=1 SV=1 1 632 0.0E+00
sp|Q38951|2AAG_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A gamma isoform OS=Arabidopsis thaliana GN=PP2AA3 PE=1 SV=2 1 626 0.0E+00
sp|Q7TNP2|2AAB_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Mus musculus GN=Ppp2r1b PE=1 SV=2 11 626 0.0E+00
sp|Q4QQT4|2AAB_RAT Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Rattus norvegicus GN=Ppp2r1b PE=2 SV=1 2 626 0.0E+00
sp|P30154|2AAB_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens GN=PPP2R1B PE=1 SV=3 11 626 0.0E+00
sp|P54613|2AAB_PIG Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (Fragment) OS=Sus scrofa GN=PPP2R1B PE=2 SV=1 1 626 0.0E+00
sp|P30153|2AAA_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens GN=PPP2R1A PE=1 SV=4 4 626 0.0E+00
sp|Q32PI5|2AAA_BOVIN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Bos taurus GN=PPP2R1A PE=1 SV=1 4 626 0.0E+00
sp|P54612|2AAA_PIG Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Sus scrofa GN=PPP2R1A PE=2 SV=2 4 626 0.0E+00
sp|Q76MZ3|2AAA_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Mus musculus GN=Ppp2r1a PE=1 SV=3 4 626 0.0E+00
sp|Q54QR9|2AAA_DICDI Serine/threonine-protein phosphatase 2A regulatory subunit pppA OS=Dictyostelium discoideum GN=pppA PE=2 SV=1 1 626 0.0E+00
sp|Q09543|2AAA_CAEEL Probable serine/threonine-protein phosphatase PP2A regulatory subunit OS=Caenorhabditis elegans GN=paa-1 PE=3 SV=2 7 626 7.0E-176
sp|P31383|2AAA_YEAST Protein phosphatase PP2A regulatory subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPD3 PE=1 SV=3 6 630 4.0E-174
sp|P36875|2AAA_PEA Protein phosphatase PP2A regulatory subunit A (Fragment) OS=Pisum sativum PE=2 SV=1 226 626 4.0E-120
sp|P36875|2AAA_PEA Protein phosphatase PP2A regulatory subunit A (Fragment) OS=Pisum sativum PE=2 SV=1 134 441 2.0E-17
sp|P54613|2AAB_PIG Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (Fragment) OS=Sus scrofa GN=PPP2R1B PE=2 SV=1 194 529 2.0E-16
sp|P30154|2AAB_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens GN=PPP2R1B PE=1 SV=3 194 529 2.0E-15
sp|Q4QQT4|2AAB_RAT Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Rattus norvegicus GN=Ppp2r1b PE=2 SV=1 194 529 3.0E-15
sp|Q7TNP2|2AAB_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Mus musculus GN=Ppp2r1b PE=1 SV=2 194 529 8.0E-15
sp|P36875|2AAA_PEA Protein phosphatase PP2A regulatory subunit A (Fragment) OS=Pisum sativum PE=2 SV=1 197 558 1.0E-13
sp|Q8VI02|PP4R1_RAT Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Rattus norvegicus GN=Ppp4r1 PE=1 SV=1 319 624 1.0E-12
sp|Q8K2V1|PP4R1_MOUSE Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Mus musculus GN=Ppp4r1 PE=1 SV=2 319 624 2.0E-12
sp|P36875|2AAA_PEA Protein phosphatase PP2A regulatory subunit A (Fragment) OS=Pisum sativum PE=2 SV=1 298 530 3.0E-12
sp|Q8TF05|PP4R1_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Homo sapiens GN=PPP4R1 PE=1 SV=1 319 628 5.0E-12
sp|Q9UT08|2AAA_SCHPO Protein phosphatase PP2A regulatory subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=paa1 PE=3 SV=1 24 412 8.0E-08
sp|Q8VI02|PP4R1_RAT Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Rattus norvegicus GN=Ppp4r1 PE=1 SV=1 243 503 2.0E-06
sp|Q8K2V1|PP4R1_MOUSE Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Mus musculus GN=Ppp4r1 PE=1 SV=2 243 503 2.0E-06
sp|Q8K2V1|PP4R1_MOUSE Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Mus musculus GN=Ppp4r1 PE=1 SV=2 215 444 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7165
MADAPNANDELYPIAVLIDELKHDDVLLRLNAIHRLSTIALALGPERTREELIPFLDESVEDEDEVLVALSEELG
GFIEYVGGPRWGHVLLSPLENLAAIEEPVVRDKVAPAYLALLASEQEALLTIAQAVESLNKICASLAPDQVEEYF
FPLTVRLSKADWFTSKISGCGLYTAPYNKVTGPVQEQLRQQFGQLVHDETPMVRRQAATNLAKFVKEMPPSVVID
EMIPFFQHLVQDDQDSVRLLTVEILVSIAEVVPKEQQASHGVLLTSLRNLIDDKSWRVRYMIADRFEKIAKAVDG
EVVTRDLVPAFVKLLKDNEAEVRTAIAGQIPGFCALIDRATLLNEVMGSIEDLVSDNSQHVRAALGTQISGLAPI
LGKQETIDHLLPMFLQMLKDEFPEVRLHIISKLELVNQVIGIDLLSQSLLPAIVQLAEDKQWRVRLAIIEYIPLL
ASQLGVKFFDEKLASLCMGWLGDTVFSIREAATHNLKKLAEVFGVEWASEQIIPKVMGMGSHPNYLYRMTTCFAI
STLATVVSIDVISRSILPMLDKMVDDDIPNIRFNVAKTYAVLIRVLRRLPEQGTIYSLEKEGAEVTPSPRGAELI
QQRITPNLNKLQKDDDVDVRYFASTAAADATGQAVEVAAGPTTGGDEPMSTSP*
Coding >OphauG2|7165
ATGGCTGACGCGCCAAACGCCAACGACGAGCTGTATCCCATTGCCGTGCTCATCGATGAGCTCAAGCATGATGAC
GTCCTTCTCCGCCTCAACGCCATCCACCGCTTGTCCACCATCGCCCTTGCTTTAGGCCCAGAGCGTACGAGAGAA
GAGCTCATTCCATTTCTCGATGAATCTGTCGAAGACGAGGACGAGGTCTTGGTCGCTCTAAGCGAGGAACTTGGT
GGTTTCATCGAGTACGTTGGAGGCCCTCGATGGGGGCATGTCTTGCTGTCACCGCTTGAGAATCTGGCTGCCATC
GAGGAGCCCGTCGTCCGAGACAAGGTAGCCCCTGCATACCTGGCACTACTCGCCTCGGAACAAGAAGCCTTGCTA
ACTATTGCTCAGGCTGTTGAATCCCTCAACAAGATCTGTGCTAGCCTTGCCCCTGATCAGGTTGAGGAGTACTTC
TTCCCTCTTACTGTTCGTCTATCAAAAGCCGACTGGTTCACTTCCAAGATTTCCGGATGCGGCCTGTATACCGCC
CCCTACAATAAAGTCACTGGGCCCGTCCAGGAGCAACTGCGCCAGCAATTTGGCCAGCTCGTCCACGACGAAACC
CCAATGGTCCGCCGGCAAGCTGCCACCAACTTGGCAAAGTTTGTCAAGGAAATGCCCCCCTCTGTCGTCATAGAC
GAGATGATACCCTTCTTTCAGCATCTGGTCCAGGATGATCAGGATAGTGTGCGACTTCTGACTGTCGAAATTCTT
GTATCCATTGCAGAGGTGGTACCAAAGGAGCAACAAGCAAGTCACGGTGTCTTGCTAACTTCGTTGCGCAATCTC
ATTGATGACAAGAGCTGGAGGGTCAGGTATATGATTGCCGATAGGTTTGAAAAGATTGCCAAGGCTGTTGACGGC
GAGGTCGTGACACGAGACTTGGTGCCTGCCTTTGTCAAGCTGCTTAAAGACAATGAGGCAGAGGTTCGCACCGCC
ATTGCAGGCCAAATCCCCGGCTTTTGCGCCCTCATTGACCGTGCCACACTGCTTAACGAAGTTATGGGGAGCATC
GAGGATCTCGTGTCAGACAATTCACAACACGTTCGCGCAGCGCTGGGAACCCAAATTAGCGGCCTAGCCCCTATA
CTGGGCAAACAAGAAACCATTGATCACTTGCTTCCAATGTTTCTGCAAATGCTCAAGGATGAATTTCCCGAAGTA
CGACTCCACATCATCTCGAAATTGGAACTGGTCAATCAAGTCATTGGAATCGATCTCCTCTCGCAGTCTCTGCTT
CCAGCAATTGTGCAGCTGGCCGAAGACAAGCAATGGAGAGTGCGGCTCGCAATTATTGAATATATCCCATTGCTA
GCTAGTCAGCTGGGGGTCAAGTTCTTTGACGAAAAGCTGGCCAGTCTGTGCATGGGATGGCTGGGGGACACAGTG
TTTTCTATTCGAGAGGCTGCTACGCACAACCTCAAGAAGCTTGCCGAAGTGTTTGGGGTCGAGTGGGCCAGCGAG
CAAATTATTCCAAAAGTAATGGGCATGGGAAGCCATCCAAACTATCTCTACAGGATGACGACATGCTTTGCCATT
TCGACGCTGGCGACGGTTGTCAGCATAGACGTCATTTCCAGGTCCATTCTGCCCATGTTGGACAAGATGGTGGAT
GACGATATTCCCAATATCCGCTTCAACGTTGCCAAGACGTACGCTGTCCTGATCAGGGTGCTGCGTCGTCTTCCA
GAGCAGGGCACCATCTACTCTTTGGAGAAGGAGGGCGCCGAGGTGACGCCGTCGCCACGGGGTGCCGAGCTGATC
CAACAGCGCATCACGCCCAACTTGAACAAGCTGCAGAAGGACGACGACGTGGACGTTCGCTACTTTGCCTCGACT
GCAGCGGCTGACGCAACAGGCCAAGCGGTTGAGGTGGCGGCAGGGCCCACGACGGGCGGCGATGAGCCCATGAGT
ACATCACCATAG
Transcript >OphauG2|7165
ATGGCTGACGCGCCAAACGCCAACGACGAGCTGTATCCCATTGCCGTGCTCATCGATGAGCTCAAGCATGATGAC
GTCCTTCTCCGCCTCAACGCCATCCACCGCTTGTCCACCATCGCCCTTGCTTTAGGCCCAGAGCGTACGAGAGAA
GAGCTCATTCCATTTCTCGATGAATCTGTCGAAGACGAGGACGAGGTCTTGGTCGCTCTAAGCGAGGAACTTGGT
GGTTTCATCGAGTACGTTGGAGGCCCTCGATGGGGGCATGTCTTGCTGTCACCGCTTGAGAATCTGGCTGCCATC
GAGGAGCCCGTCGTCCGAGACAAGGTAGCCCCTGCATACCTGGCACTACTCGCCTCGGAACAAGAAGCCTTGCTA
ACTATTGCTCAGGCTGTTGAATCCCTCAACAAGATCTGTGCTAGCCTTGCCCCTGATCAGGTTGAGGAGTACTTC
TTCCCTCTTACTGTTCGTCTATCAAAAGCCGACTGGTTCACTTCCAAGATTTCCGGATGCGGCCTGTATACCGCC
CCCTACAATAAAGTCACTGGGCCCGTCCAGGAGCAACTGCGCCAGCAATTTGGCCAGCTCGTCCACGACGAAACC
CCAATGGTCCGCCGGCAAGCTGCCACCAACTTGGCAAAGTTTGTCAAGGAAATGCCCCCCTCTGTCGTCATAGAC
GAGATGATACCCTTCTTTCAGCATCTGGTCCAGGATGATCAGGATAGTGTGCGACTTCTGACTGTCGAAATTCTT
GTATCCATTGCAGAGGTGGTACCAAAGGAGCAACAAGCAAGTCACGGTGTCTTGCTAACTTCGTTGCGCAATCTC
ATTGATGACAAGAGCTGGAGGGTCAGGTATATGATTGCCGATAGGTTTGAAAAGATTGCCAAGGCTGTTGACGGC
GAGGTCGTGACACGAGACTTGGTGCCTGCCTTTGTCAAGCTGCTTAAAGACAATGAGGCAGAGGTTCGCACCGCC
ATTGCAGGCCAAATCCCCGGCTTTTGCGCCCTCATTGACCGTGCCACACTGCTTAACGAAGTTATGGGGAGCATC
GAGGATCTCGTGTCAGACAATTCACAACACGTTCGCGCAGCGCTGGGAACCCAAATTAGCGGCCTAGCCCCTATA
CTGGGCAAACAAGAAACCATTGATCACTTGCTTCCAATGTTTCTGCAAATGCTCAAGGATGAATTTCCCGAAGTA
CGACTCCACATCATCTCGAAATTGGAACTGGTCAATCAAGTCATTGGAATCGATCTCCTCTCGCAGTCTCTGCTT
CCAGCAATTGTGCAGCTGGCCGAAGACAAGCAATGGAGAGTGCGGCTCGCAATTATTGAATATATCCCATTGCTA
GCTAGTCAGCTGGGGGTCAAGTTCTTTGACGAAAAGCTGGCCAGTCTGTGCATGGGATGGCTGGGGGACACAGTG
TTTTCTATTCGAGAGGCTGCTACGCACAACCTCAAGAAGCTTGCCGAAGTGTTTGGGGTCGAGTGGGCCAGCGAG
CAAATTATTCCAAAAGTAATGGGCATGGGAAGCCATCCAAACTATCTCTACAGGATGACGACATGCTTTGCCATT
TCGACGCTGGCGACGGTTGTCAGCATAGACGTCATTTCCAGGTCCATTCTGCCCATGTTGGACAAGATGGTGGAT
GACGATATTCCCAATATCCGCTTCAACGTTGCCAAGACGTACGCTGTCCTGATCAGGGTGCTGCGTCGTCTTCCA
GAGCAGGGCACCATCTACTCTTTGGAGAAGGAGGGCGCCGAGGTGACGCCGTCGCCACGGGGTGCCGAGCTGATC
CAACAGCGCATCACGCCCAACTTGAACAAGCTGCAGAAGGACGACGACGTGGACGTTCGCTACTTTGCCTCGACT
GCAGCGGCTGACGCAACAGGCCAAGCGGTTGAGGTGGCGGCAGGGCCCACGACGGGCGGCGATGAGCCCATGAGT
ACATCACCATAG
Gene >OphauG2|7165
ATGGCTGACGCGCCAAACGCCAACGACGAGCTGTATCCCATTGCCGTGCTCATCGATGAGCTCAAGGTGCCAAGT
TTTCTTTTTGTTGCCCGCTGCCCTCCTGTTTTGCCTGCTGACTTTGCTTGCTCCAGCATGATGACGTCCTTCTCC
GCCTCAACGCCATCCACCGCTTGTCCACCATCGCCCTTGCTTTAGGCCCAGAGCGTACGAGAGAAGAGCTCATTC
CATTTCTCGATGGTGCGTGCATCACCCCCACGGCGCTCCTACTTCCTCTCTGACTAACGAGCCTCGTACAGAATC
TGTCGAAGACGAGGACGAGGTCTTGGTCGCTCTAAGCGAGGAACTTGGTGGTTTCATCGAGTACGTTGGAGGCCC
TCGATGGGGGCATGTCTTGCTGTCACCGCTTGAGAATCTGGCTGCCATCGAGGAGCCCGTCGTCCGAGACAAGGT
AGCCCCTGCATACCTGGCACTACTCGCCTCGGAACAAGAAGCCTTGCTAACTATTGCTCAGGCTGTTGAATCCCT
CAACAAGATCTGTGCTAGCCTTGCCCCTGATCAGGTTGAGGAGTACTTCTTCCCTCTTACTGTTCGTCTATCAAA
AGCCGACTGGTTCACTTCCAAGATTTCCGGATGCGGCCTGTATACCGCCCCCTACAATAAAGTCACTGGGCCCGT
CCAGGAGCAACTGCGCCAGCAATTTGGCCAGCTCGTCCACGACGAAACCCCAATGGTCCGCCGGCAAGCTGCCAC
CAACTTGGCAAAGTTTGTCAAGGAAATGCCCCCCTCTGTCGTCATAGACGAGATGATACCCTTCTTTCAGCATCT
GGTCCAGGATGATCAGGATAGTGTGCGACTTCTGACTGTCGAAATTCTTGTATCCATTGCAGAGGTGGTACCAAA
GGAGCAACAAGCAAGTCACGGTGTCTTGCTAACTTCGTTGCGCAATCTCATTGATGACAAGAGCTGGAGGGTCAG
GTATATGATTGCCGATAGGTTTGAAAAGGTATGGCTTCTTGCACATGTCATTTCTTTTCATCGCCCCTACTCACC
TGCTCTTGCACATATAGATTGCCAAGGCTGTTGACGGCGAGGTCGTGACACGAGACTTGGTGCCTGCCTTTGTCA
AGCTGCTTAAAGACAATGAGGCAGAGGTTCGCACCGCCATTGCAGGCCAAATCCCCGGCTTTTGCGCCCTCATTG
ACCGTGCCACACTGCTTAACGAAGTTATGGGGAGCATCGAGGATCTCGTGTCAGACAATTCACAACACGTTCGCG
CAGCGCTGGGAACCCAAATTAGCGGCCTAGCCCCTATACTGGGCAAACAAGAGTAGGCCTTGTCCGCGTCAAGCT
GTTGTCTGAGCAGCCATGGGCTAACTGGGCGTATCCAGAACCATTGATCACTTGCTTCCAATGTTTCTGCAAATG
CTCAAGGATGAATTTCCCGAAGTACGACTCCACATCATCTCGAAATTGGAACTGGTCAATCAAGGTAAGTCCAAG
CTGTGAATCGTCTCGAGTTTGCTAGCCCAATGGCTAACTCGAGCAAGTCATTGGAATCGATCTCCTCTCGCAGTC
TCTGCTTCCAGCAATTGTGCAGCTGGCCGAAGACAAGCAATGGAGAGTGCGGCTCGCAATTATTGAATATATCCC
ATTGCTAGCTAGTCAGCTGGGGGTCAAGTTCTTTGACGAAAAGCTGGCCAGTCTGTGCATGGGATGGCTGGGGGA
CACAGTGTTTTCTATTCGAGAGGCTGCTACGCACAACCTCAAGAAGCTTGCCGAAGTGTTTGGGGTCGAGTGGGC
CAGCGAGCAAATTATTCCAAAAGTAATGGGCATGGGAAGCCATCCAAACTATCTCTACAGGATGACGACATGCTT
TGCCATTTCGGTGAGTATTGCAACAACAAGAGAGGTTTATTGGAGAGAAGCTAACGTGAGGCAAGACGCTGGCGA
CGGTTGTCAGCATAGACGTCATTTCCAGGTCCATTCTGCCCATGTTGGACAAGATGGTGGATGACGATATTCCCA
ATATCCGCTTCAACGTTGCCAAGACGTACGCTGTCCTGATCAGGGTGCTGCGTCGTCTTCCAGAGCAGGGCACCA
TCTACTCTTTGGAGAAGGAGGGCGCCGAGGTGACGCCGTCGCCACGGGGTGCCGAGCTGATCCAACAGCGCATCA
CGCCCAACTTGAACAAGCTGCAGAAGGACGACGACGTGGACGTTCGCTACTTTGCCTCGACTGCAGCGGCTGACG
CAACAGGCCAAGCGGTTGAGGTGGCGGCAGGGCCCACGACGGGCGGCGATGAGCCCATGAGTACATCACCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail