Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|715
Gene name
LocationContig_1184:1081..3194
Strand-
Gene length (bp)2113
Transcript length (bp)2022
Coding sequence length (bp)2022
Protein length (aa) 674

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03221 HTH_Tnp_Tc5 Tc5 transposase DNA-binding domain 1.4E-09 284 346
PF04218 CENP-B_N CENP-B N-terminal DNA-binding domain 6.4E-07 217 267

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2365
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|715 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2429
Ophiocordyceps camponoti-floridani Ophcf2|04501
Ophiocordyceps camponoti-rufipedis Ophun1|7518
Ophiocordyceps kimflemingae Ophio5|2643
Ophiocordyceps subramaniannii Hirsu2|3285

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|715
MDGSAASVMDDHHHRSHPHLHHSQHHHPFASHQQHQDVANSMAQCGPYTGGDNWLGIAISPYAVAATSYDGGHLG
EYTAYGSFMASSGCLDAMGHMAPPAMQPQHHQHHHQLIQPAPPMAHHAHGAHSHSHGLPLLNTNTAWPSQLTNPT
PTTSSAGSFTLALTPVSSGPPPTPTLPPTTTGVTAAPPPATPAAAATVKGHRPSQTTDVPKQPEKVPRKTLSAEQ
KRAMCQYSDDHPGTRQADIGAKFGVERSTVSKVLRHRDQYLKREQDPDFVLKRAKGKHPDFDRTLSNYIRRKQQR
GFEIRDDEIMEQAKLFASASGSQDELLGSLTSNWLHKFKQKHGIGSGRLMRRASETNIPDSASMSTALASIKKSR
GKKSSCSSVMSPESPTHPLSPLSGSRSDEDLHKDTLEFEFTYRAQGSQSNASLASDVPRAENCAAMNEHNMASSF
SAEALSPAASFNFSPDSNVGSFSVDGRIVPLKTEHLSPDFHHRGKRSNTFPTIDVSFVNQEQQRNHSLDEGIFAA
EPLTPRHFACASTSSSVVQSPTTDTPFNIDSALASPPPPSSLRRVSSSSSMNGRSTGAASTTSTPAESLPASPTI
EEARQAASTLLSYMHRLSTNGVIDQSDYLAAMQLTKKLQLHQHQSSRPTIGGLTRIPEGDHEMTISTETLEVR*
Coding >OphauG2|715
ATGGACGGCTCAGCCGCCAGTGTCATGGACGACCACCACCACCGCTCTCACCCTCATCTTCACCATAGCCAGCAT
CACCATCCTTTTGCTTCTCACCAGCAACACCAAGACGTGGCCAACTCAATGGCCCAATGCGGCCCCTATACTGGG
GGCGACAACTGGCTTGGAATCGCCATCAGCCCCTATGCCGTTGCTGCCACGTCGTATGACGGCGGCCATTTGGGC
GAGTACACGGCCTATGGCTCCTTCATGGCCTCGTCTGGCTGCCTCGACGCCATGGGACACATGGCTCCGCCAGCA
ATGCAACCCCAGCACCATCAACATCACCACCAGCTGATACAACCCGCGCCCCCCATGGCTCATCATGCCCATGGT
GCTCATTCTCATTCTCACGGCCTACCGCTGCTCAACACCAATACGGCCTGGCCCAGCCAGTTGACCAATCCCACT
CCCACAACCTCTTCTGCTGGAAGCTTCACTCTGGCCCTTACCCCCGTGTCCAGTGGCCCGCCTCCCACGCCCACC
TTGCCGCCCACTACCACTGGTGTCACGGCCGCGCCTCCGCCAGCCACTCCTGCAGCTGCTGCTACTGTTAAGGGC
CACCGACCCTCACAGACGACCGATGTGCCAAAGCAACCCGAAAAGGTGCCACGCAAAACCTTGAGCGCCGAACAA
AAGCGCGCCATGTGCCAGTACAGCGATGACCACCCAGGAACCAGGCAAGCCGATATTGGAGCCAAGTTTGGTGTT
GAGCGAAGCACCGTGTCCAAAGTGCTTCGACACCGTGACCAGTATCTCAAGCGCGAACAGGATCCCGATTTTGTC
CTCAAGCGCGCCAAGGGCAAGCATCCCGATTTTGACAGGACACTGAGCAACTACATTCGACGGAAACAGCAGCGG
GGCTTTGAAATCCGCGACGACGAAATCATGGAACAGGCCAAGCTGTTTGCCAGTGCTAGCGGCAGCCAGGACGAG
CTGCTGGGATCCTTGACGAGCAACTGGCTGCACAAGTTTAAGCAGAAGCACGGCATTGGCTCTGGGAGGCTCATG
CGGCGCGCTTCGGAGACGAATATTCCCGACAGCGCCAGCATGTCGACGGCCTTGGCTTCCATCAAGAAGAGCCGC
GGCAAGAAGAGCTCTTGCTCGAGCGTCATGTCCCCAGAGTCTCCAACGCATCCGCTGTCTCCCCTGTCGGGTTCG
CGCAGTGACGAGGACCTGCACAAGGACACGCTCGAATTCGAATTCACCTATAGAGCTCAGGGCTCTCAGTCCAAT
GCTTCTCTGGCCAGTGATGTTCCTCGAGCGGAAAACTGCGCCGCCATGAATGAACATAACATGGCGTCGTCCTTT
TCAGCCGAAGCGCTCAGCCCGGCAGCGTCGTTTAACTTTTCGCCAGACTCCAATGTGGGATCCTTTTCGGTAGAT
GGCCGAATCGTGCCGCTCAAGACTGAGCACCTCTCGCCCGATTTCCACCACCGCGGAAAGAGGAGCAACACGTTT
CCCACGATTGACGTTAGTTTTGTCAACCAGGAACAGCAGAGAAACCATTCTCTCGACGAAGGCATTTTTGCCGCA
GAGCCCCTGACGCCGCGCCACTTTGCTTGCGCCTCTACATCTTCCTCTGTCGTTCAGTCGCCCACGACGGATACG
CCCTTTAATATCGACTCGGCTTTGGCCTCGCCGCCGCCGCCATCGTCGCTGCGTCGTGTCAGCAGCAGCTCTAGC
ATGAATGGCCGCTCAACCGGTGCCGCTTCCACCACGAGCACTCCGGCCGAGTCGTTGCCTGCCTCGCCAACCATT
GAAGAGGCGCGTCAGGCTGCGAGCACGCTTCTCAGCTACATGCACCGCCTGAGCACGAATGGCGTCATTGACCAG
AGCGACTACTTGGCCGCCATGCAGTTGACCAAGAAGCTGCAGTTGCATCAGCATCAGAGCTCGCGCCCGACAATT
GGCGGCCTGACAAGGATTCCCGAGGGCGATCATGAAATGACTATATCGACTGAAACCTTGGAAGTGAGGTGA
Transcript >OphauG2|715
ATGGACGGCTCAGCCGCCAGTGTCATGGACGACCACCACCACCGCTCTCACCCTCATCTTCACCATAGCCAGCAT
CACCATCCTTTTGCTTCTCACCAGCAACACCAAGACGTGGCCAACTCAATGGCCCAATGCGGCCCCTATACTGGG
GGCGACAACTGGCTTGGAATCGCCATCAGCCCCTATGCCGTTGCTGCCACGTCGTATGACGGCGGCCATTTGGGC
GAGTACACGGCCTATGGCTCCTTCATGGCCTCGTCTGGCTGCCTCGACGCCATGGGACACATGGCTCCGCCAGCA
ATGCAACCCCAGCACCATCAACATCACCACCAGCTGATACAACCCGCGCCCCCCATGGCTCATCATGCCCATGGT
GCTCATTCTCATTCTCACGGCCTACCGCTGCTCAACACCAATACGGCCTGGCCCAGCCAGTTGACCAATCCCACT
CCCACAACCTCTTCTGCTGGAAGCTTCACTCTGGCCCTTACCCCCGTGTCCAGTGGCCCGCCTCCCACGCCCACC
TTGCCGCCCACTACCACTGGTGTCACGGCCGCGCCTCCGCCAGCCACTCCTGCAGCTGCTGCTACTGTTAAGGGC
CACCGACCCTCACAGACGACCGATGTGCCAAAGCAACCCGAAAAGGTGCCACGCAAAACCTTGAGCGCCGAACAA
AAGCGCGCCATGTGCCAGTACAGCGATGACCACCCAGGAACCAGGCAAGCCGATATTGGAGCCAAGTTTGGTGTT
GAGCGAAGCACCGTGTCCAAAGTGCTTCGACACCGTGACCAGTATCTCAAGCGCGAACAGGATCCCGATTTTGTC
CTCAAGCGCGCCAAGGGCAAGCATCCCGATTTTGACAGGACACTGAGCAACTACATTCGACGGAAACAGCAGCGG
GGCTTTGAAATCCGCGACGACGAAATCATGGAACAGGCCAAGCTGTTTGCCAGTGCTAGCGGCAGCCAGGACGAG
CTGCTGGGATCCTTGACGAGCAACTGGCTGCACAAGTTTAAGCAGAAGCACGGCATTGGCTCTGGGAGGCTCATG
CGGCGCGCTTCGGAGACGAATATTCCCGACAGCGCCAGCATGTCGACGGCCTTGGCTTCCATCAAGAAGAGCCGC
GGCAAGAAGAGCTCTTGCTCGAGCGTCATGTCCCCAGAGTCTCCAACGCATCCGCTGTCTCCCCTGTCGGGTTCG
CGCAGTGACGAGGACCTGCACAAGGACACGCTCGAATTCGAATTCACCTATAGAGCTCAGGGCTCTCAGTCCAAT
GCTTCTCTGGCCAGTGATGTTCCTCGAGCGGAAAACTGCGCCGCCATGAATGAACATAACATGGCGTCGTCCTTT
TCAGCCGAAGCGCTCAGCCCGGCAGCGTCGTTTAACTTTTCGCCAGACTCCAATGTGGGATCCTTTTCGGTAGAT
GGCCGAATCGTGCCGCTCAAGACTGAGCACCTCTCGCCCGATTTCCACCACCGCGGAAAGAGGAGCAACACGTTT
CCCACGATTGACGTTAGTTTTGTCAACCAGGAACAGCAGAGAAACCATTCTCTCGACGAAGGCATTTTTGCCGCA
GAGCCCCTGACGCCGCGCCACTTTGCTTGCGCCTCTACATCTTCCTCTGTCGTTCAGTCGCCCACGACGGATACG
CCCTTTAATATCGACTCGGCTTTGGCCTCGCCGCCGCCGCCATCGTCGCTGCGTCGTGTCAGCAGCAGCTCTAGC
ATGAATGGCCGCTCAACCGGTGCCGCTTCCACCACGAGCACTCCGGCCGAGTCGTTGCCTGCCTCGCCAACCATT
GAAGAGGCGCGTCAGGCTGCGAGCACGCTTCTCAGCTACATGCACCGCCTGAGCACGAATGGCGTCATTGACCAG
AGCGACTACTTGGCCGCCATGCAGTTGACCAAGAAGCTGCAGTTGCATCAGCATCAGAGCTCGCGCCCGACAATT
GGCGGCCTGACAAGGATTCCCGAGGGCGATCATGAAATGACTATATCGACTGAAACCTTGGAAGTGAGGTGA
Gene >OphauG2|715
ATGGACGGCTCAGCCGCCAGTGTCATGGACGACCACCACCACCGCTCTCACCCTCATCTTCACCATAGCCAGCAT
CACCATCCTTTTGCTTCTCACCAGCAACACCAAGACGTGGCCAACTCAATGGCCCAATGCGGCCCCTATACTGGG
GGCGACAACTGGCTTGGAATCGCCATCAGCCCCTATGCCGTTGCTGCCACGTCGTATGACGGCGGCCATTTGGGC
GAGTACACGGCCTATGGCTCCTTCATGGCCTCGTCTGGCTGCCTCGACGCCATGGGACACATGGCTCCGCCAGCA
ATGCAACCCCAGCACCATCAACATCACCACCAGCTGATACAACCCGCGCCCCCCATGGCTCATCATGCCCATGGT
GCTCATTCTCATTCTCACGGCCTACCGCTGCTCAACACCAATACGGCCTGGCCCAGCCAGTTGACCAATCCCACT
CCCACAACCTCTTCTGCTGGAAGCTTCACTCTGGCCCTTACCCCCGTGTCCAGTGGCCCGCCTCCCACGCCCACC
TTGCCGCCCACTACCACTGGTGTCACGGCCGCGCCTCCGCCAGCCACTCCTGCAGCTGCTGCTACTGTTAAGGGC
CACCGACCCTCACAGACGACCGATGTGCCAAAGCAACCCGAAAAGGTGCCACGCAAAACCTTGAGCGCCGAACAA
AAGCGCGCCATGTGCCAGTACAGCGATGACCACCCAGGAACCAGGCAAGCCGATATTGGAGCCAAGTTTGGTGTT
GAGCGAAGGTGAGCCTTGGGGCATCCTTTTGCTCAAGCATTTTTCTCCCCACTCCCCCTCTGGCAAGATTCTGAC
TAGGCCTTGGTCAAATCATTACAGCACCGTGTCCAAAGTGCTTCGACACCGTGACCAGTATCTCAAGCGCGAACA
GGATCCCGATTTTGTCCTCAAGCGCGCCAAGGGCAAGCATCCCGATTTTGACAGGACACTGAGCAACTACATTCG
ACGGAAACAGCAGCGGGGCTTTGAAATCCGCGACGACGAAATCATGGAACAGGCCAAGCTGTTTGCCAGTGCTAG
CGGCAGCCAGGACGAGCTGCTGGGATCCTTGACGAGCAACTGGCTGCACAAGTTTAAGCAGAAGCACGGCATTGG
CTCTGGGAGGCTCATGCGGCGCGCTTCGGAGACGAATATTCCCGACAGCGCCAGCATGTCGACGGCCTTGGCTTC
CATCAAGAAGAGCCGCGGCAAGAAGAGCTCTTGCTCGAGCGTCATGTCCCCAGAGTCTCCAACGCATCCGCTGTC
TCCCCTGTCGGGTTCGCGCAGTGACGAGGACCTGCACAAGGACACGCTCGAATTCGAATTCACCTATAGAGCTCA
GGGCTCTCAGTCCAATGCTTCTCTGGCCAGTGATGTTCCTCGAGCGGAAAACTGCGCCGCCATGAATGAACATAA
CATGGCGTCGTCCTTTTCAGCCGAAGCGCTCAGCCCGGCAGCGTCGTTTAACTTTTCGCCAGACTCCAATGTGGG
ATCCTTTTCGGTAGATGGCCGAATCGTGCCGCTCAAGACTGAGCACCTCTCGCCCGATTTCCACCACCGCGGAAA
GAGGAGCAACACGTTTCCCACGATTGACGTTAGTTTTGTCAACCAGGAACAGCAGAGAAACCATTCTCTCGACGA
AGGCATTTTTGCCGCAGAGCCCCTGACGCCGCGCCACTTTGCTTGCGCCTCTACATCTTCCTCTGTCGTTCAGTC
GCCCACGACGGATACGCCCTTTAATATCGACTCGGCTTTGGCCTCGCCGCCGCCGCCATCGTCGCTGCGTCGTGT
CAGCAGCAGCTCTAGCATGAATGGCCGCTCAACCGGTGCCGCTTCCACCACGAGCACTCCGGCCGAGTCGTTGCC
TGCCTCGCCAACCATTGAAGAGGCGCGTCAGGCTGCGAGCACGCTTCTCAGCTACATGCACCGCCTGAGCACGAA
TGGCGTCATTGACCAGAGCGACTACTTGGCCGCCATGCAGTTGACCAAGAAGCTGCAGTTGCATCAGCATCAGAG
CTCGCGCCCGACAATTGGCGGCCTGACAAGGATTCCCGAGGGCGATCATGAAATGACTATATCGACTGAAACCTT
GGAAGTGAGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail