Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7149
Gene name
LocationContig_80:27091..29677
Strand+
Gene length (bp)2586
Transcript length (bp)2586
Coding sequence length (bp)2586
Protein length (aa) 862

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12678 zf-rbx1 RING-H2 zinc finger domain 9.3E-11 793 855
PF13639 zf-RING_2 Ring finger domain 5.0E-08 828 855
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 2.3E-06 794 854
PF13445 zf-RING_UBOX RING-type zinc-finger 2.6E-04 794 852

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P36096|TUL1_YEAST Transmembrane E3 ubiquitin-protein ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUL1 PE=1 SV=1 250 861 2.0E-45
sp|O43085|DSC1_SCHPO DSC E3 ubiquitin ligase complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dsc1 PE=1 SV=2 338 861 5.0E-39

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 454 476 22
3 483 505 22
4 602 624 22
5 629 648 19
6 658 680 22
7 693 715 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7149
MPQTRNPAAALLLVVFLIWLLLPDGGFQGQSLVLSDVVAVRLARYHEALDVLKTTSWGDFAPPRSPEGEDQGQDD
DEDAKFVNLTGFRAQDGFAWQDLDDFRQRGLRLSRYAVDGGQLWDVAQGEAVWANASGTLRGEWIRRQGSVQRSF
ESYNLSRNVPEMDWVGHGVEWARNMTGATGRMMLRLEGNSTVMRYEDVEPPAADTDPSASQHLPLSGGAIRNVKA
TLTVEDTAGSGLNWEMRLWGVHWPRQGVVLLTTTSEKFDGILGLPHLTPSASFFRSSRRLLEQILARVLDTKSSN
ANMDQNMPWNSDVDNPQYTAYPSPHCEFVMYAQVHPPVGLHARGDAKSQQPQDMIAAIEAELQNPLGAPIRSVPR
LVMSAVVWSPDCAFFLETKGPPDFAPGPADHLTGMKTEVHTHHVKMWMLVYALLVLGQVRLLKDQVKESLTPSTL
GRISFWTISAMVMVDGMTFTAAATWVSSAAATFLPTLALMFASFLSMTIGGSFLHKMHEMQQPVARLGREQNRAS
SPRPTSSAPADQTPTTAAILPGPVTATRASGAPQQPPVIVPSDQDQAAEIAQAASAVPRPGSGDANTTPQALSFQ
SIVGRFVLASLCLCFLAISSSTWYPRPRSLLLNFCAAAYLSLWVPQIYRNAVRNCRRALAWPFVIGQSVLRLLPI
AYFWLNEDNFLYARPDRPAFFLFVAWVWIQIFVLAAQDVLGPRFGLPASWCPEAWDYHPVLREDGLEAGGLPIGL
VAAASDEHDADALHKHPSSTSHDGHASSAHVKPPAGCSLRAIDCAICREALQVPVVKAGHDDSAATGVASVFARR
LYMVTPCRHVFHTACLEGWIKFRLQCPICRDDLPPI*
Coding >OphauG2|7149
ATGCCGCAGACTCGGAATCCGGCAGCGGCGCTCCTCCTTGTCGTCTTCCTCATCTGGCTGCTTCTGCCCGACGGC
GGCTTTCAAGGCCAATCACTGGTCTTGTCAGACGTGGTGGCTGTCCGTCTCGCGCGCTACCACGAGGCTCTCGAC
GTGCTCAAGACGACGTCATGGGGCGACTTTGCGCCGCCACGCAGCCCCGAGGGAGAAGACCAAGGCCAGGATGAC
GACGAAGACGCAAAGTTTGTCAACCTCACGGGGTTCCGGGCTCAGGACGGGTTCGCATGGCAGGATCTCGACGAC
TTTCGGCAACGAGGCCTCCGACTTAGCCGATACGCCGTTGATGGAGGGCAGCTGTGGGATGTGGCGCAGGGAGAG
GCCGTGTGGGCAAACGCATCGGGGACTCTGCGGGGAGAGTGGATACGGCGCCAGGGCTCGGTGCAGCGGTCCTTT
GAAAGCTACAATCTTAGTCGTAACGTGCCCGAGATGGACTGGGTCGGGCATGGCGTCGAGTGGGCGCGCAATATG
ACGGGCGCCACAGGCCGCATGATGCTGCGACTCGAGGGTAACAGCACCGTGATGCGGTATGAGGATGTGGAGCCG
CCCGCGGCAGACACGGATCCCAGCGCCAGCCAGCATCTCCCGCTCTCTGGCGGGGCCATCCGCAACGTCAAGGCC
ACTCTGACGGTCGAGGACACGGCCGGGTCGGGCCTCAACTGGGAGATGCGGCTGTGGGGGGTGCACTGGCCGCGG
CAGGGCGTTGTTCTGCTTACCACGACGAGCGAGAAGTTTGACGGCATCTTGGGCCTGCCGCACCTCACGCCCAGC
GCCAGCTTTTTCCGCTCGAGCCGGCGCCTCCTCGAGCAGATACTGGCCCGGGTGCTTGACACCAAAAGCAGCAAC
GCCAACATGGACCAGAACATGCCCTGGAACTCCGACGTGGACAATCCGCAGTACACAGCCTATCCTTCGCCCCAC
TGCGAGTTTGTCATGTACGCCCAGGTGCACCCTCCGGTCGGCCTGCACGCGCGAGGCGATGCCAAGAGCCAGCAG
CCTCAAGACATGATTGCGGCCATTGAGGCGGAGCTGCAGAACCCACTGGGCGCGCCCATCCGCTCGGTGCCGCGT
CTCGTCATGTCCGCCGTGGTATGGTCGCCCGACTGCGCCTTTTTCCTCGAGACCAAGGGCCCGCCCGACTTTGCG
CCAGGGCCGGCAGACCATCTGACGGGCATGAAGACCGAGGTGCACACGCACCACGTCAAGATGTGGATGCTGGTG
TATGCGCTGCTTGTTCTCGGCCAGGTGCGTCTGCTCAAGGACCAGGTCAAGGAGTCGTTGACGCCGTCGACCCTG
GGCCGCATCAGCTTCTGGACCATCAGCGCCATGGTCATGGTGGACGGCATGACCTTTACCGCCGCTGCCACTTGG
GTCTCGTCGGCCGCCGCCACCTTTTTGCCTACGCTGGCCCTCATGTTTGCTTCCTTCCTCTCCATGACCATTGGC
GGCAGCTTTCTGCACAAGATGCACGAGATGCAGCAGCCAGTGGCACGGCTTGGACGCGAGCAGAACCGCGCCTCT
TCTCCCCGGCCCACCAGCTCGGCGCCGGCCGACCAGACCCCGACAACCGCCGCCATACTTCCCGGCCCGGTCACG
GCCACCCGCGCATCCGGCGCCCCGCAGCAGCCACCCGTCATTGTTCCCTCGGACCAGGACCAAGCCGCAGAAATT
GCCCAAGCCGCCTCGGCCGTGCCTCGCCCTGGTTCGGGAGATGCAAACACCACGCCCCAGGCCCTCTCCTTTCAA
TCCATTGTTGGCCGCTTCGTCCTGGCCAGTCTCTGTCTCTGCTTCCTGGCCATTTCGTCGTCGACATGGTATCCG
CGCCCTCGCTCCCTCTTGCTCAACTTTTGTGCCGCGGCCTACCTGTCTCTTTGGGTCCCCCAGATTTACCGCAAT
GCAGTGCGCAACTGTCGCCGCGCTCTGGCATGGCCCTTTGTCATTGGCCAATCTGTGCTGCGCCTACTGCCTATT
GCCTACTTTTGGCTCAATGAGGACAATTTTTTATACGCCCGCCCCGACCGTCCGGCGTTCTTCTTGTTTGTGGCC
TGGGTCTGGATCCAGATTTTCGTCCTTGCTGCCCAAGACGTGCTTGGCCCGCGCTTTGGTCTGCCTGCTTCGTGG
TGTCCCGAAGCCTGGGACTATCACCCGGTCTTGCGCGAGGATGGCCTCGAAGCGGGCGGCTTGCCCATTGGTCTC
GTGGCGGCAGCGTCGGACGAGCACGATGCCGACGCTCTGCACAAACATCCCTCTTCCACCTCTCACGACGGCCAC
GCTTCCAGTGCGCATGTCAAGCCGCCTGCTGGCTGCTCTCTGCGCGCTATTGACTGCGCAATTTGCAGAGAAGCG
CTACAGGTTCCAGTCGTGAAAGCTGGCCACGACGACAGCGCCGCAACCGGTGTTGCTAGCGTCTTTGCTCGCAGG
CTCTACATGGTGACGCCATGCCGCCATGTTTTCCACACGGCTTGCCTCGAGGGCTGGATCAAGTTTCGTCTACAA
TGCCCCATATGCCGCGACGATTTGCCGCCAATCTAG
Transcript >OphauG2|7149
ATGCCGCAGACTCGGAATCCGGCAGCGGCGCTCCTCCTTGTCGTCTTCCTCATCTGGCTGCTTCTGCCCGACGGC
GGCTTTCAAGGCCAATCACTGGTCTTGTCAGACGTGGTGGCTGTCCGTCTCGCGCGCTACCACGAGGCTCTCGAC
GTGCTCAAGACGACGTCATGGGGCGACTTTGCGCCGCCACGCAGCCCCGAGGGAGAAGACCAAGGCCAGGATGAC
GACGAAGACGCAAAGTTTGTCAACCTCACGGGGTTCCGGGCTCAGGACGGGTTCGCATGGCAGGATCTCGACGAC
TTTCGGCAACGAGGCCTCCGACTTAGCCGATACGCCGTTGATGGAGGGCAGCTGTGGGATGTGGCGCAGGGAGAG
GCCGTGTGGGCAAACGCATCGGGGACTCTGCGGGGAGAGTGGATACGGCGCCAGGGCTCGGTGCAGCGGTCCTTT
GAAAGCTACAATCTTAGTCGTAACGTGCCCGAGATGGACTGGGTCGGGCATGGCGTCGAGTGGGCGCGCAATATG
ACGGGCGCCACAGGCCGCATGATGCTGCGACTCGAGGGTAACAGCACCGTGATGCGGTATGAGGATGTGGAGCCG
CCCGCGGCAGACACGGATCCCAGCGCCAGCCAGCATCTCCCGCTCTCTGGCGGGGCCATCCGCAACGTCAAGGCC
ACTCTGACGGTCGAGGACACGGCCGGGTCGGGCCTCAACTGGGAGATGCGGCTGTGGGGGGTGCACTGGCCGCGG
CAGGGCGTTGTTCTGCTTACCACGACGAGCGAGAAGTTTGACGGCATCTTGGGCCTGCCGCACCTCACGCCCAGC
GCCAGCTTTTTCCGCTCGAGCCGGCGCCTCCTCGAGCAGATACTGGCCCGGGTGCTTGACACCAAAAGCAGCAAC
GCCAACATGGACCAGAACATGCCCTGGAACTCCGACGTGGACAATCCGCAGTACACAGCCTATCCTTCGCCCCAC
TGCGAGTTTGTCATGTACGCCCAGGTGCACCCTCCGGTCGGCCTGCACGCGCGAGGCGATGCCAAGAGCCAGCAG
CCTCAAGACATGATTGCGGCCATTGAGGCGGAGCTGCAGAACCCACTGGGCGCGCCCATCCGCTCGGTGCCGCGT
CTCGTCATGTCCGCCGTGGTATGGTCGCCCGACTGCGCCTTTTTCCTCGAGACCAAGGGCCCGCCCGACTTTGCG
CCAGGGCCGGCAGACCATCTGACGGGCATGAAGACCGAGGTGCACACGCACCACGTCAAGATGTGGATGCTGGTG
TATGCGCTGCTTGTTCTCGGCCAGGTGCGTCTGCTCAAGGACCAGGTCAAGGAGTCGTTGACGCCGTCGACCCTG
GGCCGCATCAGCTTCTGGACCATCAGCGCCATGGTCATGGTGGACGGCATGACCTTTACCGCCGCTGCCACTTGG
GTCTCGTCGGCCGCCGCCACCTTTTTGCCTACGCTGGCCCTCATGTTTGCTTCCTTCCTCTCCATGACCATTGGC
GGCAGCTTTCTGCACAAGATGCACGAGATGCAGCAGCCAGTGGCACGGCTTGGACGCGAGCAGAACCGCGCCTCT
TCTCCCCGGCCCACCAGCTCGGCGCCGGCCGACCAGACCCCGACAACCGCCGCCATACTTCCCGGCCCGGTCACG
GCCACCCGCGCATCCGGCGCCCCGCAGCAGCCACCCGTCATTGTTCCCTCGGACCAGGACCAAGCCGCAGAAATT
GCCCAAGCCGCCTCGGCCGTGCCTCGCCCTGGTTCGGGAGATGCAAACACCACGCCCCAGGCCCTCTCCTTTCAA
TCCATTGTTGGCCGCTTCGTCCTGGCCAGTCTCTGTCTCTGCTTCCTGGCCATTTCGTCGTCGACATGGTATCCG
CGCCCTCGCTCCCTCTTGCTCAACTTTTGTGCCGCGGCCTACCTGTCTCTTTGGGTCCCCCAGATTTACCGCAAT
GCAGTGCGCAACTGTCGCCGCGCTCTGGCATGGCCCTTTGTCATTGGCCAATCTGTGCTGCGCCTACTGCCTATT
GCCTACTTTTGGCTCAATGAGGACAATTTTTTATACGCCCGCCCCGACCGTCCGGCGTTCTTCTTGTTTGTGGCC
TGGGTCTGGATCCAGATTTTCGTCCTTGCTGCCCAAGACGTGCTTGGCCCGCGCTTTGGTCTGCCTGCTTCGTGG
TGTCCCGAAGCCTGGGACTATCACCCGGTCTTGCGCGAGGATGGCCTCGAAGCGGGCGGCTTGCCCATTGGTCTC
GTGGCGGCAGCGTCGGACGAGCACGATGCCGACGCTCTGCACAAACATCCCTCTTCCACCTCTCACGACGGCCAC
GCTTCCAGTGCGCATGTCAAGCCGCCTGCTGGCTGCTCTCTGCGCGCTATTGACTGCGCAATTTGCAGAGAAGCG
CTACAGGTTCCAGTCGTGAAAGCTGGCCACGACGACAGCGCCGCAACCGGTGTTGCTAGCGTCTTTGCTCGCAGG
CTCTACATGGTGACGCCATGCCGCCATGTTTTCCACACGGCTTGCCTCGAGGGCTGGATCAAGTTTCGTCTACAA
TGCCCCATATGCCGCGACGATTTGCCGCCAATCTAG
Gene >OphauG2|7149
ATGCCGCAGACTCGGAATCCGGCAGCGGCGCTCCTCCTTGTCGTCTTCCTCATCTGGCTGCTTCTGCCCGACGGC
GGCTTTCAAGGCCAATCACTGGTCTTGTCAGACGTGGTGGCTGTCCGTCTCGCGCGCTACCACGAGGCTCTCGAC
GTGCTCAAGACGACGTCATGGGGCGACTTTGCGCCGCCACGCAGCCCCGAGGGAGAAGACCAAGGCCAGGATGAC
GACGAAGACGCAAAGTTTGTCAACCTCACGGGGTTCCGGGCTCAGGACGGGTTCGCATGGCAGGATCTCGACGAC
TTTCGGCAACGAGGCCTCCGACTTAGCCGATACGCCGTTGATGGAGGGCAGCTGTGGGATGTGGCGCAGGGAGAG
GCCGTGTGGGCAAACGCATCGGGGACTCTGCGGGGAGAGTGGATACGGCGCCAGGGCTCGGTGCAGCGGTCCTTT
GAAAGCTACAATCTTAGTCGTAACGTGCCCGAGATGGACTGGGTCGGGCATGGCGTCGAGTGGGCGCGCAATATG
ACGGGCGCCACAGGCCGCATGATGCTGCGACTCGAGGGTAACAGCACCGTGATGCGGTATGAGGATGTGGAGCCG
CCCGCGGCAGACACGGATCCCAGCGCCAGCCAGCATCTCCCGCTCTCTGGCGGGGCCATCCGCAACGTCAAGGCC
ACTCTGACGGTCGAGGACACGGCCGGGTCGGGCCTCAACTGGGAGATGCGGCTGTGGGGGGTGCACTGGCCGCGG
CAGGGCGTTGTTCTGCTTACCACGACGAGCGAGAAGTTTGACGGCATCTTGGGCCTGCCGCACCTCACGCCCAGC
GCCAGCTTTTTCCGCTCGAGCCGGCGCCTCCTCGAGCAGATACTGGCCCGGGTGCTTGACACCAAAAGCAGCAAC
GCCAACATGGACCAGAACATGCCCTGGAACTCCGACGTGGACAATCCGCAGTACACAGCCTATCCTTCGCCCCAC
TGCGAGTTTGTCATGTACGCCCAGGTGCACCCTCCGGTCGGCCTGCACGCGCGAGGCGATGCCAAGAGCCAGCAG
CCTCAAGACATGATTGCGGCCATTGAGGCGGAGCTGCAGAACCCACTGGGCGCGCCCATCCGCTCGGTGCCGCGT
CTCGTCATGTCCGCCGTGGTATGGTCGCCCGACTGCGCCTTTTTCCTCGAGACCAAGGGCCCGCCCGACTTTGCG
CCAGGGCCGGCAGACCATCTGACGGGCATGAAGACCGAGGTGCACACGCACCACGTCAAGATGTGGATGCTGGTG
TATGCGCTGCTTGTTCTCGGCCAGGTGCGTCTGCTCAAGGACCAGGTCAAGGAGTCGTTGACGCCGTCGACCCTG
GGCCGCATCAGCTTCTGGACCATCAGCGCCATGGTCATGGTGGACGGCATGACCTTTACCGCCGCTGCCACTTGG
GTCTCGTCGGCCGCCGCCACCTTTTTGCCTACGCTGGCCCTCATGTTTGCTTCCTTCCTCTCCATGACCATTGGC
GGCAGCTTTCTGCACAAGATGCACGAGATGCAGCAGCCAGTGGCACGGCTTGGACGCGAGCAGAACCGCGCCTCT
TCTCCCCGGCCCACCAGCTCGGCGCCGGCCGACCAGACCCCGACAACCGCCGCCATACTTCCCGGCCCGGTCACG
GCCACCCGCGCATCCGGCGCCCCGCAGCAGCCACCCGTCATTGTTCCCTCGGACCAGGACCAAGCCGCAGAAATT
GCCCAAGCCGCCTCGGCCGTGCCTCGCCCTGGTTCGGGAGATGCAAACACCACGCCCCAGGCCCTCTCCTTTCAA
TCCATTGTTGGCCGCTTCGTCCTGGCCAGTCTCTGTCTCTGCTTCCTGGCCATTTCGTCGTCGACATGGTATCCG
CGCCCTCGCTCCCTCTTGCTCAACTTTTGTGCCGCGGCCTACCTGTCTCTTTGGGTCCCCCAGATTTACCGCAAT
GCAGTGCGCAACTGTCGCCGCGCTCTGGCATGGCCCTTTGTCATTGGCCAATCTGTGCTGCGCCTACTGCCTATT
GCCTACTTTTGGCTCAATGAGGACAATTTTTTATACGCCCGCCCCGACCGTCCGGCGTTCTTCTTGTTTGTGGCC
TGGGTCTGGATCCAGATTTTCGTCCTTGCTGCCCAAGACGTGCTTGGCCCGCGCTTTGGTCTGCCTGCTTCGTGG
TGTCCCGAAGCCTGGGACTATCACCCGGTCTTGCGCGAGGATGGCCTCGAAGCGGGCGGCTTGCCCATTGGTCTC
GTGGCGGCAGCGTCGGACGAGCACGATGCCGACGCTCTGCACAAACATCCCTCTTCCACCTCTCACGACGGCCAC
GCTTCCAGTGCGCATGTCAAGCCGCCTGCTGGCTGCTCTCTGCGCGCTATTGACTGCGCAATTTGCAGAGAAGCG
CTACAGGTTCCAGTCGTGAAAGCTGGCCACGACGACAGCGCCGCAACCGGTGTTGCTAGCGTCTTTGCTCGCAGG
CTCTACATGGTGACGCCATGCCGCCATGTTTTCCACACGGCTTGCCTCGAGGGCTGGATCAAGTTTCGTCTACAA
TGCCCCATATGCCGCGACGATTTGCCGCCAATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail