Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7135
Gene name
LocationContig_8:59676..61932
Strand-
Gene length (bp)2256
Transcript length (bp)2256
Coding sequence length (bp)2256
Protein length (aa) 752

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12739 TRAPPC-Trs85 ER-Golgi trafficking TRAPP I complex 85 kDa subunit 9.0E-107 286 671

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74748|TR852_SCHPO Transport protein particle subunit trs85-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trs85-2 PE=3 SV=1 98 670 2.0E-71
sp|O94731|TR851_SCHPO Transport protein particle subunit trs85-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trs85-1 PE=3 SV=1 110 670 6.0E-55
sp|P46944|TRS85_YEAST Trafficking protein particle complex III-specific subunit 85 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRS85 PE=1 SV=2 248 670 7.0E-18
sp|Q9Y2L5|TPPC8_HUMAN Trafficking protein particle complex subunit 8 OS=Homo sapiens GN=TRAPPC8 PE=1 SV=2 110 392 2.0E-15
sp|Q9Y2L5|TPPC8_HUMAN Trafficking protein particle complex subunit 8 OS=Homo sapiens GN=TRAPPC8 PE=1 SV=2 400 671 7.0E-15

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7135
MPLPAQDGSSKEPVQALPAATSVMRISKTRHSSPPAEPLPTSQQEASLPFRRSNPSAASLYASTLSPPDSRPMSP
VGRAAPFHGRTIFDNFTRDASNSTGNEKVDEPLGLILQSFVPRVAVYASKDTEALMTEKGLRHGLWELLRPFGEA
VQGKVTVRDSNGVSRTFDDFAIRFTNLDRDVEYAASASRPQTLNSAVGQKEDPESATKDRKILADIETVIDLHLS
FGERSLADMSAPVHQDSGNRATSPYYALYLRRLLSATPLAPQESFAHPVACVIAISSRTENPIEELGKLYLDTSQ
GPKKFPPWVNGEYLRYYVLVHDEDKDDISASVNLFEQMKRNLGLHCHLLRLRCSQSAETDDDSIPLPRSDWIYAA
EELVELNGNANTEEPEDSTRRIFESDATAIRTFVREMVTQSIVPTMERHVSVWNDQVASRRRGLTGRFMSLSRKW
TGFGGGSRSSSGPGGNPREGYELLGYYRADTPEATMRKLADYAFMLRDWKLAQLTYDLLRSDFGESKAWKYHAAV
NEMAATSLLLISQALTSKLRAETVDQMLESALYSYGTRCSSPYGAVRSILLGLELLRLRGGSSADDASRWGLRLL
ESKLLGRVGDALVKERLAVCYASKAGVGKRGWGSRHRKSAAWSTLAADAWCQQAKYVAAKRCIGEAQRSYQLPSD
SRGIRGFTFAVEYMESLEEELANKLGLANDQDRNNGNEPIEQDSETLTDGGVQRANIKAGDNTMEIAPLHGHGAR
G*
Coding >OphauG2|7135
ATGCCACTGCCTGCTCAGGATGGTTCGTCCAAAGAACCGGTTCAGGCACTGCCTGCAGCCACCTCTGTCATGAGG
ATATCCAAGACACGGCATTCAAGCCCTCCCGCCGAGCCGTTGCCGACGTCCCAGCAAGAAGCCAGCCTGCCATTC
CGAAGATCGAACCCATCAGCCGCCTCATTATATGCGTCGACCTTGTCTCCTCCCGATTCCAGACCCATGTCTCCT
GTAGGACGAGCCGCTCCATTTCACGGAAGGACTATTTTCGATAATTTTACTCGAGATGCGTCCAACAGTACAGGA
AACGAGAAAGTCGATGAGCCTCTGGGACTGATATTACAATCTTTCGTGCCGCGTGTTGCCGTCTACGCGTCGAAA
GATACAGAAGCTCTCATGACCGAAAAGGGTCTCCGCCATGGGCTATGGGAACTATTACGTCCGTTTGGCGAAGCA
GTCCAAGGCAAAGTCACGGTTCGCGACAGTAATGGCGTTAGTCGGACTTTTGACGACTTTGCGATCCGCTTCACT
AATCTCGACCGCGATGTGGAATATGCTGCGTCAGCCTCAAGGCCTCAGACATTAAACTCGGCCGTTGGTCAAAAA
GAGGACCCAGAGAGTGCGACAAAGGATAGAAAGATTCTGGCAGACATTGAGACAGTCATTGATCTGCATCTATCG
TTTGGGGAACGGTCTCTAGCTGACATGTCTGCACCCGTGCATCAAGACTCGGGAAATCGGGCGACATCTCCCTAC
TATGCCCTGTACTTGAGACGTCTGCTGTCTGCCACTCCCCTTGCGCCCCAAGAGTCTTTCGCGCATCCGGTGGCT
TGCGTAATTGCTATCAGCTCAAGAACGGAAAACCCCATTGAAGAGCTTGGGAAGCTCTATCTGGACACGAGCCAG
GGCCCGAAAAAGTTCCCACCGTGGGTCAACGGCGAATACCTTCGGTATTATGTTCTTGTACATGATGAGGACAAG
GATGACATCTCCGCGTCTGTGAATCTGTTTGAGCAGATGAAGCGCAATCTCGGACTGCACTGCCATTTGCTTCGC
TTGCGGTGTAGCCAGAGCGCAGAGACAGACGACGACAGCATACCACTGCCTCGCAGCGACTGGATATATGCTGCT
GAAGAACTTGTCGAGTTGAATGGAAATGCCAACACTGAAGAGCCTGAGGATTCGACGCGGCGCATCTTTGAGTCT
GACGCAACAGCGATTCGGACCTTTGTGCGCGAAATGGTAACGCAATCCATTGTGCCTACAATGGAGCGACATGTC
TCGGTATGGAATGATCAGGTGGCATCTCGGCGCCGAGGCCTCACTGGGCGCTTCATGAGTCTGTCACGTAAATGG
ACCGGCTTCGGCGGTGGCTCTCGTTCATCTTCTGGCCCTGGCGGAAATCCTCGAGAGGGCTATGAATTACTGGGC
TATTACCGCGCCGACACGCCCGAGGCAACAATGAGGAAACTGGCCGACTACGCATTCATGCTCCGCGACTGGAAG
CTGGCGCAGTTGACATATGATCTCTTGCGGTCCGATTTTGGCGAGTCCAAGGCTTGGAAATATCATGCAGCAGTC
AACGAAATGGCAGCCACCAGCCTGCTGCTGATATCGCAGGCGCTCACATCCAAGCTTCGGGCCGAGACAGTCGAC
CAGATGCTAGAATCGGCTCTGTACTCCTACGGCACCCGATGTAGCTCGCCGTATGGTGCTGTGCGAAGCATCTTG
CTCGGGCTCGAGCTGCTTCGCTTGCGGGGGGGCAGCAGTGCGGATGATGCCAGCAGATGGGGGCTCCGGCTACTC
GAATCAAAACTACTGGGCCGTGTCGGAGATGCCCTGGTCAAGGAACGACTTGCAGTTTGCTATGCTTCCAAAGCA
GGCGTTGGGAAACGAGGCTGGGGGAGTCGCCATCGCAAGTCGGCGGCATGGAGCACCCTCGCAGCTGACGCCTGG
TGTCAACAAGCCAAGTATGTTGCAGCGAAGCGATGCATTGGCGAGGCGCAGAGGAGCTACCAATTACCTTCAGAT
TCGCGTGGTATTCGTGGATTCACCTTTGCCGTGGAATATATGGAATCTCTCGAGGAAGAGCTCGCCAACAAGCTT
GGCCTTGCAAATGACCAGGACAGGAATAACGGGAACGAGCCAATTGAACAAGACAGTGAAACGTTGACAGATGGT
GGTGTCCAACGAGCCAACATCAAGGCGGGAGACAATACCATGGAAATCGCACCGCTGCACGGACACGGCGCTAGG
GGCTAG
Transcript >OphauG2|7135
ATGCCACTGCCTGCTCAGGATGGTTCGTCCAAAGAACCGGTTCAGGCACTGCCTGCAGCCACCTCTGTCATGAGG
ATATCCAAGACACGGCATTCAAGCCCTCCCGCCGAGCCGTTGCCGACGTCCCAGCAAGAAGCCAGCCTGCCATTC
CGAAGATCGAACCCATCAGCCGCCTCATTATATGCGTCGACCTTGTCTCCTCCCGATTCCAGACCCATGTCTCCT
GTAGGACGAGCCGCTCCATTTCACGGAAGGACTATTTTCGATAATTTTACTCGAGATGCGTCCAACAGTACAGGA
AACGAGAAAGTCGATGAGCCTCTGGGACTGATATTACAATCTTTCGTGCCGCGTGTTGCCGTCTACGCGTCGAAA
GATACAGAAGCTCTCATGACCGAAAAGGGTCTCCGCCATGGGCTATGGGAACTATTACGTCCGTTTGGCGAAGCA
GTCCAAGGCAAAGTCACGGTTCGCGACAGTAATGGCGTTAGTCGGACTTTTGACGACTTTGCGATCCGCTTCACT
AATCTCGACCGCGATGTGGAATATGCTGCGTCAGCCTCAAGGCCTCAGACATTAAACTCGGCCGTTGGTCAAAAA
GAGGACCCAGAGAGTGCGACAAAGGATAGAAAGATTCTGGCAGACATTGAGACAGTCATTGATCTGCATCTATCG
TTTGGGGAACGGTCTCTAGCTGACATGTCTGCACCCGTGCATCAAGACTCGGGAAATCGGGCGACATCTCCCTAC
TATGCCCTGTACTTGAGACGTCTGCTGTCTGCCACTCCCCTTGCGCCCCAAGAGTCTTTCGCGCATCCGGTGGCT
TGCGTAATTGCTATCAGCTCAAGAACGGAAAACCCCATTGAAGAGCTTGGGAAGCTCTATCTGGACACGAGCCAG
GGCCCGAAAAAGTTCCCACCGTGGGTCAACGGCGAATACCTTCGGTATTATGTTCTTGTACATGATGAGGACAAG
GATGACATCTCCGCGTCTGTGAATCTGTTTGAGCAGATGAAGCGCAATCTCGGACTGCACTGCCATTTGCTTCGC
TTGCGGTGTAGCCAGAGCGCAGAGACAGACGACGACAGCATACCACTGCCTCGCAGCGACTGGATATATGCTGCT
GAAGAACTTGTCGAGTTGAATGGAAATGCCAACACTGAAGAGCCTGAGGATTCGACGCGGCGCATCTTTGAGTCT
GACGCAACAGCGATTCGGACCTTTGTGCGCGAAATGGTAACGCAATCCATTGTGCCTACAATGGAGCGACATGTC
TCGGTATGGAATGATCAGGTGGCATCTCGGCGCCGAGGCCTCACTGGGCGCTTCATGAGTCTGTCACGTAAATGG
ACCGGCTTCGGCGGTGGCTCTCGTTCATCTTCTGGCCCTGGCGGAAATCCTCGAGAGGGCTATGAATTACTGGGC
TATTACCGCGCCGACACGCCCGAGGCAACAATGAGGAAACTGGCCGACTACGCATTCATGCTCCGCGACTGGAAG
CTGGCGCAGTTGACATATGATCTCTTGCGGTCCGATTTTGGCGAGTCCAAGGCTTGGAAATATCATGCAGCAGTC
AACGAAATGGCAGCCACCAGCCTGCTGCTGATATCGCAGGCGCTCACATCCAAGCTTCGGGCCGAGACAGTCGAC
CAGATGCTAGAATCGGCTCTGTACTCCTACGGCACCCGATGTAGCTCGCCGTATGGTGCTGTGCGAAGCATCTTG
CTCGGGCTCGAGCTGCTTCGCTTGCGGGGGGGCAGCAGTGCGGATGATGCCAGCAGATGGGGGCTCCGGCTACTC
GAATCAAAACTACTGGGCCGTGTCGGAGATGCCCTGGTCAAGGAACGACTTGCAGTTTGCTATGCTTCCAAAGCA
GGCGTTGGGAAACGAGGCTGGGGGAGTCGCCATCGCAAGTCGGCGGCATGGAGCACCCTCGCAGCTGACGCCTGG
TGTCAACAAGCCAAGTATGTTGCAGCGAAGCGATGCATTGGCGAGGCGCAGAGGAGCTACCAATTACCTTCAGAT
TCGCGTGGTATTCGTGGATTCACCTTTGCCGTGGAATATATGGAATCTCTCGAGGAAGAGCTCGCCAACAAGCTT
GGCCTTGCAAATGACCAGGACAGGAATAACGGGAACGAGCCAATTGAACAAGACAGTGAAACGTTGACAGATGGT
GGTGTCCAACGAGCCAACATCAAGGCGGGAGACAATACCATGGAAATCGCACCGCTGCACGGACACGGCGCTAGG
GGCTAG
Gene >OphauG2|7135
ATGCCACTGCCTGCTCAGGATGGTTCGTCCAAAGAACCGGTTCAGGCACTGCCTGCAGCCACCTCTGTCATGAGG
ATATCCAAGACACGGCATTCAAGCCCTCCCGCCGAGCCGTTGCCGACGTCCCAGCAAGAAGCCAGCCTGCCATTC
CGAAGATCGAACCCATCAGCCGCCTCATTATATGCGTCGACCTTGTCTCCTCCCGATTCCAGACCCATGTCTCCT
GTAGGACGAGCCGCTCCATTTCACGGAAGGACTATTTTCGATAATTTTACTCGAGATGCGTCCAACAGTACAGGA
AACGAGAAAGTCGATGAGCCTCTGGGACTGATATTACAATCTTTCGTGCCGCGTGTTGCCGTCTACGCGTCGAAA
GATACAGAAGCTCTCATGACCGAAAAGGGTCTCCGCCATGGGCTATGGGAACTATTACGTCCGTTTGGCGAAGCA
GTCCAAGGCAAAGTCACGGTTCGCGACAGTAATGGCGTTAGTCGGACTTTTGACGACTTTGCGATCCGCTTCACT
AATCTCGACCGCGATGTGGAATATGCTGCGTCAGCCTCAAGGCCTCAGACATTAAACTCGGCCGTTGGTCAAAAA
GAGGACCCAGAGAGTGCGACAAAGGATAGAAAGATTCTGGCAGACATTGAGACAGTCATTGATCTGCATCTATCG
TTTGGGGAACGGTCTCTAGCTGACATGTCTGCACCCGTGCATCAAGACTCGGGAAATCGGGCGACATCTCCCTAC
TATGCCCTGTACTTGAGACGTCTGCTGTCTGCCACTCCCCTTGCGCCCCAAGAGTCTTTCGCGCATCCGGTGGCT
TGCGTAATTGCTATCAGCTCAAGAACGGAAAACCCCATTGAAGAGCTTGGGAAGCTCTATCTGGACACGAGCCAG
GGCCCGAAAAAGTTCCCACCGTGGGTCAACGGCGAATACCTTCGGTATTATGTTCTTGTACATGATGAGGACAAG
GATGACATCTCCGCGTCTGTGAATCTGTTTGAGCAGATGAAGCGCAATCTCGGACTGCACTGCCATTTGCTTCGC
TTGCGGTGTAGCCAGAGCGCAGAGACAGACGACGACAGCATACCACTGCCTCGCAGCGACTGGATATATGCTGCT
GAAGAACTTGTCGAGTTGAATGGAAATGCCAACACTGAAGAGCCTGAGGATTCGACGCGGCGCATCTTTGAGTCT
GACGCAACAGCGATTCGGACCTTTGTGCGCGAAATGGTAACGCAATCCATTGTGCCTACAATGGAGCGACATGTC
TCGGTATGGAATGATCAGGTGGCATCTCGGCGCCGAGGCCTCACTGGGCGCTTCATGAGTCTGTCACGTAAATGG
ACCGGCTTCGGCGGTGGCTCTCGTTCATCTTCTGGCCCTGGCGGAAATCCTCGAGAGGGCTATGAATTACTGGGC
TATTACCGCGCCGACACGCCCGAGGCAACAATGAGGAAACTGGCCGACTACGCATTCATGCTCCGCGACTGGAAG
CTGGCGCAGTTGACATATGATCTCTTGCGGTCCGATTTTGGCGAGTCCAAGGCTTGGAAATATCATGCAGCAGTC
AACGAAATGGCAGCCACCAGCCTGCTGCTGATATCGCAGGCGCTCACATCCAAGCTTCGGGCCGAGACAGTCGAC
CAGATGCTAGAATCGGCTCTGTACTCCTACGGCACCCGATGTAGCTCGCCGTATGGTGCTGTGCGAAGCATCTTG
CTCGGGCTCGAGCTGCTTCGCTTGCGGGGGGGCAGCAGTGCGGATGATGCCAGCAGATGGGGGCTCCGGCTACTC
GAATCAAAACTACTGGGCCGTGTCGGAGATGCCCTGGTCAAGGAACGACTTGCAGTTTGCTATGCTTCCAAAGCA
GGCGTTGGGAAACGAGGCTGGGGGAGTCGCCATCGCAAGTCGGCGGCATGGAGCACCCTCGCAGCTGACGCCTGG
TGTCAACAAGCCAAGTATGTTGCAGCGAAGCGATGCATTGGCGAGGCGCAGAGGAGCTACCAATTACCTTCAGAT
TCGCGTGGTATTCGTGGATTCACCTTTGCCGTGGAATATATGGAATCTCTCGAGGAAGAGCTCGCCAACAAGCTT
GGCCTTGCAAATGACCAGGACAGGAATAACGGGAACGAGCCAATTGAACAAGACAGTGAAACGTTGACAGATGGT
GGTGTCCAACGAGCCAACATCAAGGCGGGAGACAATACCATGGAAATCGCACCGCTGCACGGACACGGCGCTAGG
GGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail