Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7132
Gene name
LocationContig_8:52953..54239
Strand+
Gene length (bp)1286
Transcript length (bp)1221
Coding sequence length (bp)1221
Protein length (aa) 407

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 3.1E-13 28 66
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.3E-08 29 66
PF13445 zf-RING_UBOX RING-type zinc-finger 9.3E-08 29 64
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 3.7E-07 27 68
PF14634 zf-RING_5 zinc-RING finger domain 4.1E-07 28 67
PF13639 zf-RING_2 Ring finger domain 2.2E-06 28 67

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02398|RAD18_EMENI Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uvsH PE=2 SV=1 5 324 3.0E-90
sp|P33288|RAD18_NEUCR Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=uvs-2 PE=3 SV=2 6 325 1.0E-89
sp|Q4WZJ6|RAD18_ASPFU Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad18 PE=3 SV=1 5 326 3.0E-89
sp|O74747|RAD18_SCHPO Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp18 PE=3 SV=1 1 325 2.0E-43
sp|Q6CHI1|RAD18_YARLI Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD18 PE=3 SV=1 5 325 1.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02398|RAD18_EMENI Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uvsH PE=2 SV=1 5 324 3.0E-90
sp|P33288|RAD18_NEUCR Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=uvs-2 PE=3 SV=2 6 325 1.0E-89
sp|Q4WZJ6|RAD18_ASPFU Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad18 PE=3 SV=1 5 326 3.0E-89
sp|O74747|RAD18_SCHPO Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp18 PE=3 SV=1 1 325 2.0E-43
sp|Q6CHI1|RAD18_YARLI Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD18 PE=3 SV=1 5 325 1.0E-41
sp|Q75EN0|RAD18_ASHGO Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD18 PE=3 SV=1 3 328 1.0E-33
sp|P10862|RAD18_YEAST Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD18 PE=1 SV=1 4 351 2.0E-30
sp|Q6FPI4|RAD18_CANGA Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD18 PE=3 SV=1 11 331 5.0E-29
sp|Q9NS91|RAD18_HUMAN E3 ubiquitin-protein ligase RAD18 OS=Homo sapiens GN=RAD18 PE=1 SV=2 17 325 7.0E-27
sp|Q9QXK2|RAD18_MOUSE E3 ubiquitin-protein ligase RAD18 OS=Mus musculus GN=Rad18 PE=1 SV=2 17 363 3.0E-26
sp|Q6CTZ8|RAD18_KLULA Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD18 PE=3 SV=1 6 325 4.0E-24
sp|Q5A4N5|RAD18_CANAL Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD18 PE=3 SV=1 1 323 1.0E-22
sp|Q6BLM3|RAD18_DEBHA Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD18 PE=3 SV=2 4 174 2.0E-19
sp|Q6BLM3|RAD18_DEBHA Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD18 PE=3 SV=2 210 361 4.0E-10
sp|Q9D4H7|LONF3_MOUSE LON peptidase N-terminal domain and RING finger protein 3 OS=Mus musculus GN=Lonrf3 PE=2 SV=1 13 89 2.0E-07
sp|Q8HXH0|LONF3_MACFA LON peptidase N-terminal domain and RING finger protein 3 OS=Macaca fascicularis GN=LONRF3 PE=2 SV=1 13 89 3.0E-07
sp|Q496Y0|LONF3_HUMAN LON peptidase N-terminal domain and RING finger protein 3 OS=Homo sapiens GN=LONRF3 PE=1 SV=1 13 89 3.0E-07
sp|Q9HCM9|TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens GN=TRIM39 PE=1 SV=2 29 105 2.0E-06
sp|Q1XHU0|TRI39_PANTR E3 ubiquitin-protein ligase TRIM39 OS=Pan troglodytes GN=TRIM39 PE=3 SV=1 29 105 2.0E-06
sp|Q03605|YNN1_CAEEL Uncharacterized RING finger protein T02C1.1 OS=Caenorhabditis elegans GN=T02C1.1 PE=3 SV=1 29 68 2.0E-06
sp|Q8RXD4|BRCA1_ARATH Protein BREAST CANCER SUSCEPTIBILITY 1 homolog OS=Arabidopsis thaliana GN=BRCA1 PE=1 SV=1 27 150 5.0E-06
sp|Q865W2|TRI50_PIG E3 ubiquitin-protein ligase TRIM50 OS=Sus scrofa GN=TRIM50 PE=2 SV=1 23 88 6.0E-06
sp|Q5BK82|TRI69_RAT E3 ubiquitin-protein ligase TRIM69 OS=Rattus norvegicus GN=Trim69 PE=1 SV=1 23 86 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5604
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7132 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1131
Ophiocordyceps camponoti-floridani Ophcf2|05586
Ophiocordyceps camponoti-rufipedis Ophun1|7591
Ophiocordyceps kimflemingae Ophio5|2796
Ophiocordyceps subramaniannii Hirsu2|7588

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7132
MSGQEIPDSTDWLATPLSGLAAVESALRCQVCKDFYKTPMMTSCSHTFCSLCIRRALSSDGRCPLCRAMEQELKL
RSNLSLEEAVEAFIHARSVILPIASEALAPPPSPRKRKEAQQEAQSPPKRLRTSARLSKNRTAHTPQDQSGAPSP
QSTDETSEPQDLVPCPSCQREMKAWQVFDHLQACPGPSDTSNAPLPLITQLAPRPDKSHERLPALNYSMLKEQAL
RKKLAELGISSQGPRFLLEKRHREWMTLWNSNCDAARPKRRLELLRDLDVWERTQGGKAPTTGKDVQTAAAIKDK
SFDGAAWAAKHDSSFKHLIISARRAKAEAQSVVDTDHGNGRQGQEADDDGVAAPSPTITEPAKCSSPAIPQDSLE
THELASSHLPIDSASDALQMASRGSREECNL*
Coding >OphauG2|7132
ATGTCTGGACAAGAAATACCCGACTCGACCGACTGGCTCGCCACTCCGCTATCCGGACTTGCCGCCGTGGAATCA
GCTCTGCGCTGCCAAGTGTGCAAAGACTTTTACAAGACGCCAATGATGACTTCGTGTTCACATACTTTTTGCTCC
CTGTGTATTCGAAGAGCGTTGTCCAGCGACGGCAGGTGTCCGCTCTGTCGCGCCATGGAACAGGAGCTCAAGCTG
CGCAGCAACCTGTCGCTCGAAGAGGCCGTCGAGGCTTTTATCCATGCCAGATCAGTCATCTTGCCCATTGCCTCT
GAAGCTTTGGCGCCGCCACCTTCGCCGAGAAAGAGGAAAGAGGCGCAGCAGGAGGCGCAGAGCCCCCCTAAGCGC
TTGCGCACCTCGGCTCGCCTCAGCAAGAACCGTACGGCGCATACGCCTCAAGACCAGTCTGGCGCGCCAAGTCCG
CAATCCACGGACGAGACATCTGAACCCCAAGACCTCGTTCCCTGCCCTTCTTGCCAGCGAGAAATGAAGGCATGG
CAAGTCTTTGATCACCTGCAAGCCTGTCCAGGCCCTTCCGATACCAGTAACGCGCCTTTACCATTAATTACCCAA
CTCGCGCCCCGTCCTGACAAGTCACACGAACGTCTACCCGCTCTCAACTATTCCATGCTTAAAGAACAAGCCTTG
CGCAAGAAACTTGCCGAACTCGGCATTTCAAGTCAGGGCCCACGCTTCTTGCTTGAAAAGCGCCATAGGGAATGG
ATGACCCTTTGGAATTCTAATTGTGACGCCGCCCGACCCAAACGGCGGTTGGAGCTTCTTCGCGATCTCGACGTT
TGGGAGCGCACTCAAGGCGGCAAAGCACCCACGACTGGCAAAGACGTGCAGACAGCCGCAGCTATTAAAGACAAA
AGCTTTGATGGCGCAGCCTGGGCCGCCAAGCACGATTCATCTTTTAAACATCTTATTATCAGTGCGAGGAGGGCC
AAGGCCGAGGCGCAATCAGTCGTCGACACAGATCATGGAAATGGAAGACAAGGACAAGAAGCCGATGATGACGGT
GTTGCAGCCCCATCGCCAACCATCACGGAGCCAGCCAAGTGTTCCAGCCCCGCGATACCCCAAGATTCGCTAGAG
ACCCACGAGCTTGCTTCATCTCATCTTCCTATCGACTCAGCGTCTGATGCCTTGCAAATGGCATCTAGAGGCTCG
AGAGAAGAGTGCAACCTCTGA
Transcript >OphauG2|7132
ATGTCTGGACAAGAAATACCCGACTCGACCGACTGGCTCGCCACTCCGCTATCCGGACTTGCCGCCGTGGAATCA
GCTCTGCGCTGCCAAGTGTGCAAAGACTTTTACAAGACGCCAATGATGACTTCGTGTTCACATACTTTTTGCTCC
CTGTGTATTCGAAGAGCGTTGTCCAGCGACGGCAGGTGTCCGCTCTGTCGCGCCATGGAACAGGAGCTCAAGCTG
CGCAGCAACCTGTCGCTCGAAGAGGCCGTCGAGGCTTTTATCCATGCCAGATCAGTCATCTTGCCCATTGCCTCT
GAAGCTTTGGCGCCGCCACCTTCGCCGAGAAAGAGGAAAGAGGCGCAGCAGGAGGCGCAGAGCCCCCCTAAGCGC
TTGCGCACCTCGGCTCGCCTCAGCAAGAACCGTACGGCGCATACGCCTCAAGACCAGTCTGGCGCGCCAAGTCCG
CAATCCACGGACGAGACATCTGAACCCCAAGACCTCGTTCCCTGCCCTTCTTGCCAGCGAGAAATGAAGGCATGG
CAAGTCTTTGATCACCTGCAAGCCTGTCCAGGCCCTTCCGATACCAGTAACGCGCCTTTACCATTAATTACCCAA
CTCGCGCCCCGTCCTGACAAGTCACACGAACGTCTACCCGCTCTCAACTATTCCATGCTTAAAGAACAAGCCTTG
CGCAAGAAACTTGCCGAACTCGGCATTTCAAGTCAGGGCCCACGCTTCTTGCTTGAAAAGCGCCATAGGGAATGG
ATGACCCTTTGGAATTCTAATTGTGACGCCGCCCGACCCAAACGGCGGTTGGAGCTTCTTCGCGATCTCGACGTT
TGGGAGCGCACTCAAGGCGGCAAAGCACCCACGACTGGCAAAGACGTGCAGACAGCCGCAGCTATTAAAGACAAA
AGCTTTGATGGCGCAGCCTGGGCCGCCAAGCACGATTCATCTTTTAAACATCTTATTATCAGTGCGAGGAGGGCC
AAGGCCGAGGCGCAATCAGTCGTCGACACAGATCATGGAAATGGAAGACAAGGACAAGAAGCCGATGATGACGGT
GTTGCAGCCCCATCGCCAACCATCACGGAGCCAGCCAAGTGTTCCAGCCCCGCGATACCCCAAGATTCGCTAGAG
ACCCACGAGCTTGCTTCATCTCATCTTCCTATCGACTCAGCGTCTGATGCCTTGCAAATGGCATCTAGAGGCTCG
AGAGAAGAGTGCAACCTCTGA
Gene >OphauG2|7132
ATGTCTGGACAAGAAATACCCGACTCGACCGACTGGCTCGCCACTCCGCTATCCGGACTTGCCGCCGTGGAATCA
GCTCTGCGCTGCCAAGTGTGCAAAGACTTTTACAAGACGCCAATGATGACTTCGTGTTCACATACTTTTTGCTCC
CTGTGTATTCGAAGAGCGTTGTCCAGCGACGGCAGGTGTCCGCTCTGTCGCGCCATGGAACAGGAGCTCAAGCTG
CGCAGCAACCTGTCGCTCGAAGAGGCCGTCGAGGCTTTTATCCATGCCAGATCAGTCATCTTGCCCATTGCCTCT
GAAGCTTTGGCGCCGCCACCTTCGCCGAGAAAGAGGAAAGAGGCGCAGCAGGAGGCGCAGAGCCCCCCTAAGCGC
TTGCGCACCTCGGCTCGCCTCAGCAAGAACCGTACGGCGCATACGCCTCAAGACCAGTCTGGCGCGCCAAGTCCG
CAATCCACGGACGAGACATCTGAACGTGACGGCACGTCTCTCTCTTACATTTCACTTCAGAACTCAACCATTGCT
GACCTACCCCAACAGCCCAAGACCTCGTTCCCTGCCCTTCTTGCCAGCGAGAAATGAAGGCATGGCAAGTCTTTG
ATCACCTGCAAGCCTGTCCAGGCCCTTCCGATACCAGTAACGCGCCTTTACCATTAATTACCCAACTCGCGCCCC
GTCCTGACAAGTCACACGAACGTCTACCCGCTCTCAACTATTCCATGCTTAAAGAACAAGCCTTGCGCAAGAAAC
TTGCCGAACTCGGCATTTCAAGTCAGGGCCCACGCTTCTTGCTTGAAAAGCGCCATAGGGAATGGATGACCCTTT
GGAATTCTAATTGTGACGCCGCCCGACCCAAACGGCGGTTGGAGCTTCTTCGCGATCTCGACGTTTGGGAGCGCA
CTCAAGGCGGCAAAGCACCCACGACTGGCAAAGACGTGCAGACAGCCGCAGCTATTAAAGACAAAAGCTTTGATG
GCGCAGCCTGGGCCGCCAAGCACGATTCATCTTTTAAACATCTTATTATCAGTGCGAGGAGGGCCAAGGCCGAGG
CGCAATCAGTCGTCGACACAGATCATGGAAATGGAAGACAAGGACAAGAAGCCGATGATGACGGTGTTGCAGCCC
CATCGCCAACCATCACGGAGCCAGCCAAGTGTTCCAGCCCCGCGATACCCCAAGATTCGCTAGAGACCCACGAGC
TTGCTTCATCTCATCTTCCTATCGACTCAGCGTCTGATGCCTTGCAAATGGCATCTAGAGGCTCGAGAGAAGAGT
GCAACCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail