Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7128
Gene name
LocationContig_8:43905..44643
Strand-
Gene length (bp)738
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00929 RNase_T Exonuclease 2.2E-17 66 216
PF01612 DNA_pol_A_exo1 3'-5' exonuclease 2.3E-05 56 198

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IEV5|REXO4_GIBZE RNA exonuclease 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=REX4 PE=3 SV=1 1 234 3.0E-103
sp|Q4WHF8|REXO4_ASPFU RNA exonuclease 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rex4 PE=3 SV=1 41 234 4.0E-68
sp|Q7S9B7|REXO4_NEUCR RNA exonuclease 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rex-4 PE=3 SV=1 62 231 3.0E-66
sp|Q6BIK6|REXO4_DEBHA RNA exonuclease 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=REX4 PE=3 SV=2 10 224 1.0E-63
sp|Q6FQA0|REXO4_CANGA RNA exonuclease 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=REX4 PE=3 SV=1 58 231 1.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IEV5|REXO4_GIBZE RNA exonuclease 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=REX4 PE=3 SV=1 1 234 3.0E-103
sp|Q4WHF8|REXO4_ASPFU RNA exonuclease 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rex4 PE=3 SV=1 41 234 4.0E-68
sp|Q7S9B7|REXO4_NEUCR RNA exonuclease 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rex-4 PE=3 SV=1 62 231 3.0E-66
sp|Q6BIK6|REXO4_DEBHA RNA exonuclease 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=REX4 PE=3 SV=2 10 224 1.0E-63
sp|Q6FQA0|REXO4_CANGA RNA exonuclease 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=REX4 PE=3 SV=1 58 231 1.0E-61
sp|Q08237|REXO4_YEAST RNA exonuclease 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX4 PE=1 SV=1 16 227 3.0E-61
sp|Q757I9|REXO4_ASHGO RNA exonuclease 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=REX4 PE=3 SV=1 27 234 3.0E-60
sp|Q6CMT3|REXO4_KLULA RNA exonuclease 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=REX4 PE=3 SV=1 49 232 4.0E-59
sp|Q4PER6|REXO4_USTMA RNA exonuclease 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=REX4 PE=3 SV=1 12 224 1.0E-52
sp|O94375|REXO4_SCHPO RNA exonuclease 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rex4 PE=3 SV=1 62 224 1.0E-50
sp|Q5A3Q0|REXO4_CANAL RNA exonuclease 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=REX4 PE=3 SV=1 63 224 3.0E-50
sp|P0CQ44|REXO4_CRYNJ RNA exonuclease 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=REX4 PE=3 SV=1 53 224 3.0E-47
sp|P0CQ45|REXO4_CRYNB RNA exonuclease 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=REX4 PE=3 SV=1 53 224 3.0E-47
sp|Q9GZR2|REXO4_HUMAN RNA exonuclease 4 OS=Homo sapiens GN=REXO4 PE=1 SV=2 29 225 8.0E-46
sp|Q6PAQ4|REXO4_MOUSE RNA exonuclease 4 OS=Mus musculus GN=Rexo4 PE=2 SV=2 62 230 2.0E-45
sp|Q91560|REXO4_XENLA RNA exonuclease 4 OS=Xenopus laevis GN=rexo4 PE=2 SV=2 14 231 2.0E-45
sp|Q6DEW6|REXO4_XENTR RNA exonuclease 4 OS=Xenopus tropicalis GN=rexo4 PE=2 SV=1 14 245 1.0E-44
sp|Q6CE69|REXO4_YARLI RNA exonuclease 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=REX4 PE=3 SV=1 63 223 2.0E-43
sp|Q96AZ6|ISG20_HUMAN Interferon-stimulated gene 20 kDa protein OS=Homo sapiens GN=ISG20 PE=1 SV=2 66 217 8.0E-31
sp|Q8WTP8|AEN_HUMAN Apoptosis-enhancing nuclease OS=Homo sapiens GN=AEN PE=1 SV=2 55 228 2.0E-30
sp|Q66UW5|ISG20_PIG Interferon-stimulated gene 20 kDa protein OS=Sus scrofa GN=Isg20 PE=1 SV=2 66 217 3.0E-30
sp|B2GUW6|AEN_RAT Apoptosis-enhancing nuclease OS=Rattus norvegicus GN=Aen PE=2 SV=1 64 217 3.0E-30
sp|Q5REE2|AEN_PONAB Apoptosis-enhancing nuclease OS=Pongo abelii GN=AEN PE=2 SV=1 12 228 5.0E-30
sp|Q2YDK1|I20L2_BOVIN Interferon-stimulated 20 kDa exonuclease-like 2 OS=Bos taurus GN=ISG20L2 PE=2 SV=1 63 224 7.0E-29
sp|Q9CZI9|AEN_MOUSE Apoptosis-enhancing nuclease OS=Mus musculus GN=Aen PE=2 SV=1 64 228 7.0E-28
sp|Q9H9L3|I20L2_HUMAN Interferon-stimulated 20 kDa exonuclease-like 2 OS=Homo sapiens GN=ISG20L2 PE=1 SV=1 64 224 7.0E-28
sp|Q6AXU3|I20L2_RAT Interferon-stimulated 20 kDa exonuclease-like 2 OS=Rattus norvegicus GN=Isg20l2 PE=2 SV=1 64 224 1.0E-27
sp|Q3U1G5|I20L2_MOUSE Interferon-stimulated 20 kDa exonuclease-like 2 OS=Mus musculus GN=Isg20l2 PE=1 SV=2 46 224 1.0E-27
sp|Q9JL16|ISG20_MOUSE Interferon-stimulated gene 20 kDa protein OS=Mus musculus GN=Isg20 PE=1 SV=1 62 169 4.0E-23
sp|P53331|REXO1_YEAST RNA exonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNH70 PE=1 SV=1 67 213 1.0E-18
sp|Q54U94|REXO4_DICDI RNA exonuclease 4 OS=Dictyostelium discoideum GN=rexo4 PE=3 SV=1 60 225 1.0E-16
sp|A3KPE8|SDN1_ARATH Small RNA degrading nuclease 1 OS=Arabidopsis thaliana GN=SDN1 PE=2 SV=1 66 213 3.0E-16
sp|Q6FIU7|REXO3_CANGA RNA exonuclease 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=REX3 PE=3 SV=1 39 217 4.0E-16
sp|O94443|YFE9_SCHPO Uncharacterized exonuclease C637.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC637.09 PE=3 SV=2 64 209 4.0E-16
sp|Q8RXK2|SDN3_ARATH Small RNA degrading nuclease 3 OS=Arabidopsis thaliana GN=SDN3 PE=1 SV=1 64 213 8.0E-16
sp|Q9FFG1|SDN2_ARATH Small RNA degrading nuclease 2 OS=Arabidopsis thaliana GN=SDN2 PE=2 SV=1 46 213 3.0E-15
sp|Q4R9F7|REXON_MACFA Putative RNA exonuclease NEF-sp OS=Macaca fascicularis GN=QtsA-10054 PE=2 SV=1 67 234 1.0E-14
sp|Q6CFE7|REXO3_YARLI RNA exonuclease 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=REX3 PE=3 SV=1 66 219 3.0E-14
sp|Q2T9U5|REXON_BOVIN Putative RNA exonuclease NEF-sp OS=Bos taurus PE=2 SV=1 67 234 4.0E-14
sp|Q96IC2|REXON_HUMAN Putative RNA exonuclease NEF-sp OS=Homo sapiens GN=44M2.3 PE=2 SV=1 67 240 5.0E-14
sp|Q5APK0|PAN2_CANAL PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAN2 PE=3 SV=1 50 220 4.0E-13
sp|Q8L7M4|SDN5_ARATH Small RNA degrading nuclease 5 OS=Arabidopsis thaliana GN=SDN5 PE=2 SV=2 59 223 5.0E-13
sp|P48778|GOR_PANTR Exonuclease GOR OS=Pan troglodytes GN=REXO1L1 PE=2 SV=3 67 227 2.0E-12
sp|Q750A5|REXO3_ASHGO RNA exonuclease 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=REX3 PE=3 SV=1 66 220 2.0E-12
sp|P53010|PAN2_YEAST PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAN2 PE=1 SV=1 44 219 3.0E-12
sp|Q8IX06|GOR_HUMAN Putative exonuclease GOR OS=Homo sapiens GN=REXO1L1P PE=5 SV=2 67 227 2.0E-11
sp|Q754X1|PAN2_ASHGO PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAN2 PE=3 SV=2 58 219 5.0E-11
sp|A5DAD0|PAN2_PICGU PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAN2 PE=3 SV=3 58 220 5.0E-11
sp|Q6C462|PAN2_YARLI PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAN2 PE=3 SV=2 83 220 6.0E-11
sp|Q6CMN5|PAN2_KLULA PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAN2 PE=3 SV=1 65 219 6.0E-11
sp|Q10124|PQE1_CAEEL Putative RNA exonuclease pqe-1 OS=Caenorhabditis elegans GN=pqe-1 PE=3 SV=2 67 216 1.0E-10
sp|Q12090|REXO3_YEAST RNA exonuclease 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX3 PE=1 SV=1 66 213 2.0E-10
sp|A3LRV8|PAN2_PICST PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAN2 PE=3 SV=2 42 219 3.0E-10
sp|Q6FS70|PAN2_CANGA PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAN2 PE=3 SV=1 14 219 4.0E-10
sp|Q7TT28|REXO1_MOUSE RNA exonuclease 1 homolog OS=Mus musculus GN=Rexo1 PE=1 SV=1 67 215 6.0E-10
sp|Q6CJB5|REXO3_KLULA RNA exonuclease 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=REX3 PE=3 SV=1 66 218 2.0E-09
sp|Q9SN09|SDN4_ARATH Putative small RNA degrading nuclease 4 OS=Arabidopsis thaliana GN=SDN4 PE=3 SV=1 63 208 3.0E-09
sp|Q504Q3|PAN2_HUMAN PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Homo sapiens GN=PAN2 PE=1 SV=3 56 219 3.0E-09
sp|A5E1W0|PAN2_LODEL PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAN2 PE=3 SV=1 94 219 3.0E-09
sp|Q8BGF7|PAN2_MOUSE PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Mus musculus GN=Pan2 PE=1 SV=1 56 219 4.0E-09
sp|Q6IE70|PAN2_RAT PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Rattus norvegicus GN=Pan2 PE=2 SV=1 56 219 4.0E-09
sp|P0CQ08|PAN2_CRYNJ PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAN2 PE=3 SV=1 42 217 2.0E-08
sp|P0CQ09|PAN2_CRYNB PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAN2 PE=3 SV=1 42 217 2.0E-08
sp|Q5F450|PAN2_CHICK PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Gallus gallus GN=PAN2 PE=2 SV=1 56 219 3.0E-08
sp|A1A5R7|REXON_RAT Putative RNA exonuclease NEF-sp OS=Rattus norvegicus PE=2 SV=1 67 213 6.0E-08
sp|Q6BZ78|PAN2_DEBHA PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAN2 PE=3 SV=2 58 209 4.0E-07
sp|Q8N1G1|REXO1_HUMAN RNA exonuclease 1 homolog OS=Homo sapiens GN=REXO1 PE=1 SV=3 67 215 8.0E-07
sp|A4RF51|PAN2_MAGO7 PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAN2 PE=3 SV=3 83 220 1.0E-06
sp|P53015|YPO4_CAEEL Uncharacterized protein F31E3.4 OS=Caenorhabditis elegans GN=F31E3.4 PE=4 SV=1 28 219 2.0E-06
sp|Q2GSV2|PAN2_CHAGB PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAN2 PE=3 SV=2 83 224 2.0E-06
sp|P0C581|PAN2_NEUCR PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pan2 PE=1 SV=2 83 229 2.0E-06
sp|O68045|DPO3E_RHOCB DNA polymerase III subunit epsilon-like protein OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=dnaQ PE=3 SV=1 36 233 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0006139 nucleobase-containing compound metabolic process Yes
GO:0008408 3'-5' exonuclease activity Yes
GO:0006807 nitrogen compound metabolic process No
GO:0004518 nuclease activity No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0004527 exonuclease activity No
GO:0008152 metabolic process No
GO:0016787 hydrolase activity No
GO:0046483 heterocycle metabolic process No
GO:0009987 cellular process No
GO:1901360 organic cyclic compound metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7128
MGVVHSEEKLGPVPSVFLWDADSDTSTQDLADAYKLGLGRESIETASKEDKINHGLIEGHQIGKYVAIDCEMVGI
GPGGYESALARVSLVDFHGKQIYDSYVKPQEKVTDWRTAVSGISPKEMKFARDFTEVQRQVSAIMENRILVAHDI
HHDLDALKLKHPARDIRDTVMHLEFRTYADGRKPSLRVLASNVLGVVIQNGAHSSIEDARITMFIFRKHKAEFDA
RHALRYGARHNKTKSKKKKK*
Coding >OphauG2|7128
ATGGGTGTCGTACATAGCGAAGAGAAACTAGGTCCTGTGCCTTCGGTATTTCTCTGGGATGCCGACAGCGACACA
TCAACACAAGATCTGGCAGATGCATATAAACTTGGACTCGGACGCGAATCGATTGAAACAGCTTCTAAAGAGGAT
AAGATCAACCATGGTCTGATCGAAGGCCACCAAATCGGCAAATATGTGGCCATCGATTGTGAGATGGTGGGCATT
GGACCTGGCGGATACGAATCGGCACTTGCTAGGGTCAGCTTGGTCGACTTTCACGGGAAACAAATCTACGATTCA
TACGTGAAGCCACAGGAGAAAGTCACAGATTGGAGAACTGCTGTGAGCGGCATCTCACCAAAGGAAATGAAATTT
GCCCGCGACTTTACCGAGGTTCAACGACAGGTATCCGCCATTATGGAAAATCGCATCCTGGTGGCACATGACATC
CATCATGATCTTGACGCTTTGAAGCTGAAGCACCCGGCGCGTGACATTCGAGACACAGTCATGCACCTTGAATTC
AGAACGTATGCGGACGGGAGGAAACCATCTCTTCGCGTGCTCGCTTCCAATGTCCTTGGTGTCGTGATTCAAAAT
GGAGCGCACTCTAGCATCGAGGATGCTCGCATAACCATGTTCATCTTTAGGAAACACAAGGCAGAGTTTGACGCG
AGACATGCACTTCGATACGGAGCCCGTCACAATAAAACCAAGTCCAAGAAGAAAAAAAAATAA
Transcript >OphauG2|7128
ATGGGTGTCGTACATAGCGAAGAGAAACTAGGTCCTGTGCCTTCGGTATTTCTCTGGGATGCCGACAGCGACACA
TCAACACAAGATCTGGCAGATGCATATAAACTTGGACTCGGACGCGAATCGATTGAAACAGCTTCTAAAGAGGAT
AAGATCAACCATGGTCTGATCGAAGGCCACCAAATCGGCAAATATGTGGCCATCGATTGTGAGATGGTGGGCATT
GGACCTGGCGGATACGAATCGGCACTTGCTAGGGTCAGCTTGGTCGACTTTCACGGGAAACAAATCTACGATTCA
TACGTGAAGCCACAGGAGAAAGTCACAGATTGGAGAACTGCTGTGAGCGGCATCTCACCAAAGGAAATGAAATTT
GCCCGCGACTTTACCGAGGTTCAACGACAGGTATCCGCCATTATGGAAAATCGCATCCTGGTGGCACATGACATC
CATCATGATCTTGACGCTTTGAAGCTGAAGCACCCGGCGCGTGACATTCGAGACACAGTCATGCACCTTGAATTC
AGAACGTATGCGGACGGGAGGAAACCATCTCTTCGCGTGCTCGCTTCCAATGTCCTTGGTGTCGTGATTCAAAAT
GGAGCGCACTCTAGCATCGAGGATGCTCGCATAACCATGTTCATCTTTAGGAAACACAAGGCAGAGTTTGACGCG
AGACATGCACTTCGATACGGAGCCCGTCACAATAAAACCAAGTCCAAGAAGAAAAAAAAATAA
Gene >OphauG2|7128
ATGGGTGTCGTACATAGCGAAGAGAAACTAGGTCCTGTGCCTTCGGTATTTCTCTGGGATGCCGACAGCGACACA
TCAACACAAGATCTGGCAGATGCATATAAACTTGGACTCGGACGCGAATCGATTGAAACAGCTTCTAAAGAGGAT
AAGATCAACCATGGTCTGATCGAAGGCCACCAAATCGGCAAATATGTGGCCATCGATTGTGAGATGGTGGGCATT
GGACCTGGCGGATACGAATCGGCACTTGCTAGGGTCAGCTTGGTCGACTTTCACGGGAAACAAATCTACGATTCA
TACGTGAAGCCACAGGAGAAAGTCACAGATTGGAGAACTGCTGTGAGCGGCATCTCACCAAAGGAAATGAAATTT
GCCCGCGACTTTACCGAGGTTCAACGACAGGTATCCGCCATTATGGAAAATCGCATCCTGGTGGCACATGACATC
CATCATGATCTTGACGCTTTGAAGCTGAAGCACCCGGCGCGTGACATTCGAGACACAGTCATGCACCTTGAATTC
AGAACGTATGCGGACGGGAGGAAACCATCTCTTCGCGTGCTCGCTTCCAATGTCCTTGGTGTCGTGATTCAAAAT
GGAGCGCACTCTAGCATCGAGGATGCTCGCATAACCATGTTCATCTTTAGGAAACACAAGGCAGAGTTTGACGCG
AGACATGCACTTCGATACGGAGCCCGTCACAATAAAACCAAGTCCAAGAAGAAAAAAAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail