Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7127
Gene name
LocationContig_8:42158..43736
Strand+
Gene length (bp)1578
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02353 CMAS Mycolic acid cyclopropane synthetase 7.1E-69 149 434
PF08241 Methyltransf_11 Methyltransferase domain 3.2E-11 216 314
PF13649 Methyltransf_25 Methyltransferase domain 5.3E-11 215 312
PF13489 Methyltransf_23 Methyltransferase domain 1.0E-09 207 321

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O53732|UFAA1_MYCTU Tuberculostearic acid methyltransferase UfaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ufaA1 PE=1 SV=3 77 446 2.0E-62
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 72 450 1.0E-41
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 72 450 1.0E-41
sp|P31049|FAMT_PSEPU Probable fatty acid methyltransferase OS=Pseudomonas putida PE=3 SV=1 152 430 3.0E-35
sp|O69687|FAMT_MYCTU Probable fatty acid methyltransferase Rv3720 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3720 PE=1 SV=4 89 396 7.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O53732|UFAA1_MYCTU Tuberculostearic acid methyltransferase UfaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ufaA1 PE=1 SV=3 77 446 2.0E-62
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 72 450 1.0E-41
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 72 450 1.0E-41
sp|P31049|FAMT_PSEPU Probable fatty acid methyltransferase OS=Pseudomonas putida PE=3 SV=1 152 430 3.0E-35
sp|O69687|FAMT_MYCTU Probable fatty acid methyltransferase Rv3720 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3720 PE=1 SV=4 89 396 7.0E-31
sp|P9WPB6|CMAS1_MYCTO Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA1 PE=3 SV=1 143 391 1.0E-30
sp|P9WPB7|CMAS1_MYCTU Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA1 PE=1 SV=1 143 391 1.0E-30
sp|A5U866|CMAS1_MYCTA Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=cmaA1 PE=1 SV=1 143 391 1.0E-30
sp|Q7U1K1|MMAA4_MYCBO Hydroxymycolate synthase MmaA4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA PE=1 SV=1 151 447 9.0E-27
sp|Q79FX8|MMAA4_MYCTU Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA4 PE=1 SV=1 151 447 1.0E-26
sp|A5U027|MMAA4_MYCTA Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA4 PE=1 SV=1 151 447 1.0E-26
sp|P9WPB3|CMAS3_MYCTU Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pcaA PE=1 SV=1 151 396 3.0E-26
sp|P9WPB2|CMAS3_MYCTO Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pcaA PE=3 SV=1 151 396 3.0E-26
sp|Q79FX6|MMAA2_MYCTU Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA2 PE=1 SV=1 143 391 8.0E-25
sp|A5U029|MMAA2_MYCTA Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA2 PE=1 SV=1 143 391 8.0E-25
sp|Q49807|CMAS2_MYCLE Cyclopropane mycolic acid synthase 2 OS=Mycobacterium leprae (strain TN) GN=cmaA2 PE=3 SV=1 152 396 1.0E-24
sp|P0CH91|MMAA3_MYCTU Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA3 PE=1 SV=1 141 430 2.0E-24
sp|A5U028|MMAA3_MYCTA Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA3 PE=1 SV=1 141 430 2.0E-24
sp|Q7U1K0|MMAA3_MYCBO Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaB PE=1 SV=1 141 430 2.0E-24
sp|Q7U1J9|MMAA2_MYCBO Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaC PE=1 SV=1 142 391 2.0E-24
sp|I1RNL0|C9MT2_GIBZE Sphingolipid C9-methyltransferase 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT2 PE=3 SV=1 143 425 3.0E-24
sp|I1RJD6|C9MT1_GIBZE Sphingolipid C9-methyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT1 PE=3 SV=1 152 429 3.0E-24
sp|P9WPB1|MMAA1_MYCTU Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA1 PE=1 SV=1 156 396 1.0E-22
sp|P9WPB0|MMAA1_MYCTO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mmaA1 PE=3 SV=1 156 396 1.0E-22
sp|A5U030|MMAA1_MYCTA Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA1 PE=1 SV=1 156 396 1.0E-22
sp|P0A5Q1|MMAA1_MYCBO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaD PE=3 SV=1 156 396 1.0E-22
sp|Q5APD4|C9MT_CANAL Sphingolipid C9-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MTS1 PE=1 SV=1 152 396 2.0E-21
sp|P9WPB5|CMAS2_MYCTU Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA2 PE=1 SV=1 152 396 3.0E-21
sp|P9WPB4|CMAS2_MYCTO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA2 PE=3 SV=1 152 396 3.0E-21
sp|P0A5P1|CMAS2_MYCBO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA2 PE=3 SV=1 152 396 3.0E-21
sp|C4R7Z3|C9MT_PICPG Sphingolipid C9-methyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0465 PE=1 SV=1 152 424 9.0E-20
sp|Q6MX39|UMAA_MYCTU S-adenosylmethionine-dependent methyltransferase UmaA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=umaA PE=1 SV=1 156 438 9.0E-19
sp|Q7XB08|CNMT_PAPSO (S)-coclaurine N-methyltransferase OS=Papaver somniferum GN=CNMT PE=1 SV=1 191 391 4.0E-09
sp|H2E7T8|SMTL1_BOTBR Sterol methyltransferase-like 1 OS=Botryococcus braunii GN=SMT-1 PE=2 SV=1 100 345 4.0E-08
sp|Q759S7|ERG6_ASHGO Sterol 24-C-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG6 PE=3 SV=1 190 330 7.0E-08
sp|Q96WX4|ERG6_PNECA Sterol 24-C-methyltransferase OS=Pneumocystis carinii GN=erg6 PE=2 SV=1 190 353 3.0E-07
sp|Q9KJ20|GSDMT_ACTHA Glycine/sarcosine/dimethylglycine N-methyltransferase OS=Actinopolyspora halophila PE=1 SV=1 187 314 1.0E-06
sp|C3SBW0|PNMT_THLFG Pavine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 191 428 1.0E-06
sp|C3SBS8|TNMT_ESCCA (S)-tetrahydroprotoberberine N-methyltransferase OS=Eschscholzia californica PE=1 SV=1 156 412 7.0E-06
sp|Q108P1|TNMT_PAPSO (S)-tetrahydroprotoberberine N-methyltransferase OS=Papaver somniferum PE=1 SV=1 191 410 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7127
MLRTLVGGWTWTPALALAKPSILSVFSRINSGTLLLVDEPGQTRHVFGQKLSGELPDSTALHPRCASTVPRVEVV
VKNDAFWMRLFLFADMGFAEAFMLGDFECHDLTSFFQLFIANRQSLDNGTTYISTLSSALSTLARSTNTLSNSLL
NVSAHYDISNQMFAAFLSPDMTYSCPIWNLDKKDGPSPHETLEQAQIRKLAYFIHGAKIKPTDHVLEIGTGWGSF
AIEAVRTTGCRVTSLTLSAQQKNLAEQRVHQAGLSHLIDIKLMDYRQLPVPQVPYDKIISIEMLEAVGRDYLSTY
FACIHRLLKKDGGIAMFQCITMPEGRHDAYSRSEDFINHYIFPGGYLPSITQLLDHISEQSHGTLIVEHVKNIGG
HYAKTLRLWNESFQQNFEATIKPALLEEHPGMTKSAIEVFRRKWQYYFAYCEAGFLTKTLGDVIITVGREGALEL
MEGIPL*
Coding >OphauG2|7127
ATGCTGCGCACTCTAGTCGGCGGCTGGACCTGGACCCCGGCCCTCGCCCTGGCCAAGCCCTCCATCCTCTCCGTC
TTTTCCCGCATCAACTCCGGCACCCTCTTGCTCGTCGATGAGCCTGGCCAGACGAGACATGTCTTTGGCCAGAAG
CTCTCGGGCGAGCTCCCCGATTCCACCGCCCTCCACCCCCGATGCGCCAGCACCGTGCCCCGAGTCGAAGTCGTC
GTCAAGAATGACGCTTTCTGGATGCGTCTCTTTCTCTTCGCCGACATGGGCTTCGCAGAGGCCTTTATGCTTGGC
GATTTCGAGTGCCATGACCTCACTTCCTTCTTCCAGCTCTTTATTGCCAATCGCCAATCTCTAGACAATGGCACC
ACCTACATCTCGACTCTGTCATCTGCCCTTTCCACCCTGGCTCGTTCCACAAATACCCTCTCAAACAGCCTGCTC
AACGTGTCAGCTCATTACGATATAAGCAACCAAATGTTTGCCGCCTTTCTCTCTCCCGATATGACCTACTCATGC
CCCATTTGGAATCTTGACAAAAAAGATGGGCCCTCCCCCCATGAAACTCTCGAGCAAGCACAAATCAGAAAACTC
GCTTACTTTATCCACGGCGCCAAGATCAAGCCCACTGATCACGTTTTGGAAATCGGTACGGGATGGGGGTCCTTT
GCCATTGAGGCTGTCAGAACCACTGGCTGCCGAGTCACCAGTCTCACCCTTTCTGCCCAACAAAAGAATCTGGCC
GAGCAACGGGTTCACCAAGCTGGCTTAAGCCATCTTATAGATATCAAGCTCATGGATTATCGCCAATTGCCCGTT
CCACAAGTTCCTTACGATAAAATTATCTCGATAGAAATGCTCGAGGCCGTTGGCCGTGACTATCTATCCACCTAT
TTCGCATGTATTCATCGCTTGCTAAAAAAGGACGGCGGCATTGCCATGTTCCAGTGCATCACAATGCCCGAGGGT
CGCCATGACGCCTATTCCCGATCCGAGGACTTCATCAACCATTACATATTTCCTGGTGGTTATCTACCCTCAATA
ACACAGCTGCTTGACCACATTTCTGAGCAATCTCATGGCACGCTGATTGTCGAACATGTAAAGAACATTGGAGGC
CACTACGCAAAAACCTTGCGCTTGTGGAACGAGAGCTTTCAACAAAACTTTGAAGCAACAATAAAGCCTGCCTTG
CTTGAAGAGCATCCTGGAATGACCAAGTCAGCTATTGAAGTCTTTCGCAGAAAATGGCAATACTACTTTGCCTAT
TGCGAAGCCGGCTTCTTGACAAAGACCCTAGGCGATGTCATCATTACTGTCGGGCGTGAAGGCGCTTTGGAATTA
ATGGAGGGTATTCCACTCTAG
Transcript >OphauG2|7127
ATGCTGCGCACTCTAGTCGGCGGCTGGACCTGGACCCCGGCCCTCGCCCTGGCCAAGCCCTCCATCCTCTCCGTC
TTTTCCCGCATCAACTCCGGCACCCTCTTGCTCGTCGATGAGCCTGGCCAGACGAGACATGTCTTTGGCCAGAAG
CTCTCGGGCGAGCTCCCCGATTCCACCGCCCTCCACCCCCGATGCGCCAGCACCGTGCCCCGAGTCGAAGTCGTC
GTCAAGAATGACGCTTTCTGGATGCGTCTCTTTCTCTTCGCCGACATGGGCTTCGCAGAGGCCTTTATGCTTGGC
GATTTCGAGTGCCATGACCTCACTTCCTTCTTCCAGCTCTTTATTGCCAATCGCCAATCTCTAGACAATGGCACC
ACCTACATCTCGACTCTGTCATCTGCCCTTTCCACCCTGGCTCGTTCCACAAATACCCTCTCAAACAGCCTGCTC
AACGTGTCAGCTCATTACGATATAAGCAACCAAATGTTTGCCGCCTTTCTCTCTCCCGATATGACCTACTCATGC
CCCATTTGGAATCTTGACAAAAAAGATGGGCCCTCCCCCCATGAAACTCTCGAGCAAGCACAAATCAGAAAACTC
GCTTACTTTATCCACGGCGCCAAGATCAAGCCCACTGATCACGTTTTGGAAATCGGTACGGGATGGGGGTCCTTT
GCCATTGAGGCTGTCAGAACCACTGGCTGCCGAGTCACCAGTCTCACCCTTTCTGCCCAACAAAAGAATCTGGCC
GAGCAACGGGTTCACCAAGCTGGCTTAAGCCATCTTATAGATATCAAGCTCATGGATTATCGCCAATTGCCCGTT
CCACAAGTTCCTTACGATAAAATTATCTCGATAGAAATGCTCGAGGCCGTTGGCCGTGACTATCTATCCACCTAT
TTCGCATGTATTCATCGCTTGCTAAAAAAGGACGGCGGCATTGCCATGTTCCAGTGCATCACAATGCCCGAGGGT
CGCCATGACGCCTATTCCCGATCCGAGGACTTCATCAACCATTACATATTTCCTGGTGGTTATCTACCCTCAATA
ACACAGCTGCTTGACCACATTTCTGAGCAATCTCATGGCACGCTGATTGTCGAACATGTAAAGAACATTGGAGGC
CACTACGCAAAAACCTTGCGCTTGTGGAACGAGAGCTTTCAACAAAACTTTGAAGCAACAATAAAGCCTGCCTTG
CTTGAAGAGCATCCTGGAATGACCAAGTCAGCTATTGAAGTCTTTCGCAGAAAATGGCAATACTACTTTGCCTAT
TGCGAAGCCGGCTTCTTGACAAAGACCCTAGGCGATGTCATCATTACTGTCGGGCGTGAAGGCGCTTTGGAATTA
ATGGAGGGTATTCCACTCTAG
Gene >OphauG2|7127
ATGCTGCGCACTCTAGTCGGCGGCTGGACCTGGACCCCGGCCCTCGCCCTGGCCAAGCCCTCCATCCTCTCCGTC
TTTTCCCGCATCAACTCCGGCACCCTCTTGCTCGTCGATGAGCCTGGCCAGACGAGACATGTCTTTGGCCAGAAG
CTCTCGGGCGAGCTCCCCGATTCCACCGCCCTCCACCCCCGATGCGCCAGCACCGTGCCCCGAGTCGAAGTCGTC
GTCAAGAATGACGCTTTCTGGATGCGTCTCTTTCTCTTCGCCGACATGGGCTTCGCAGAGGCCTTTATGCTTGGC
GATTTCGAGTGCCATGACCTCACTTCCTTCTTCCAGGTGACAGCCGCTGCCACCTCCTGACCCAAGTCTCTCTGT
ATCTCCCCACTCACCGCCAACAGCTCTTTATTGCCAATCGCCAATCTCTAGACAATGGCACCACCTACATCTCGA
CTCTGTCATCTGCCCTTTCCACCCTGGCTCGTTCCACAAATACCCTCTCAAACAGCCTGCTCAACGTGTCAGCTC
ATTACGATATAAGCAACCAAATGTTTGCCGCCTTTCTCTCTCCCGATATGACCTACTCATGCCCCATTTGGAATC
TTGACAAAAAAGATGGGCCCTCCCCCCATGAAACTCTCGAGCAAGCACAAATCAGAAAACTCGCTTACTTTATCC
ACGGCGCCAAGATCAAGCCCACTGATCACGTTTTGGAAATCGGTACGGGATGGGGGTCCTTTGCCATTGAGGCTG
TCAGAACCACTGGCTGCCGAGTCACCAGTCTCACCCTTTCTGCCCAACAAAAGAATCTGGCCGAGCAACGGGTTC
ACCAAGCTGGCTTAAGCCATCTTATAGATATCAAGCTCATGGATTATCGCCAATTGCCCGTTCCACAAGTTCCTT
ACGATAAAATTATCTCGATAGAAATGCTCGAGGCCGTTGGCCGTGACTATCTATCCACCTATTTCGCATGTATTC
ATCGCTTGCTAAAAAAGGACGGCGGCATTGCCATGTTCCAGTGCATCACAATGCCCGAGGGTCGCCATGACGCCT
ATTCCCGATCCGAGGAGTAAGTTTTTAATGCCTCAAGCTCACCTCAACTCACCATGACCAAAAATGGCATCGGCA
AGATGGACTAATATTCAACGCAGCTTCATCAACCATTACATATTTCCTGGTGGTTATCTACCCTCAATAACACAG
CTGCTTGACCACATTTCTGAGCAATCTCATGGCACGCTGATTGTCGAACATGTAAAGAACATTGGAGGCCACTAC
GCAAAAACCTTGCGCTTGTGGAACGAGAGCTTTCAACAAAACTTTGAAGCAACAATAAAGCCTGCCTTGCTTGAA
GAGCATCCTGGAATGACCAAGTCAGCTATTGAAGTCTTTCGCAGAAAATGGCAAGTGAGTAATCCCAACTCCTAA
TCAAGACTCTCTTGCCCGACAAAGACATTGACTGAGCTCAAGTACTACTTTGCCTATTGCGAAGCCGGCTTCTTG
ACAAAGACCCTAGGCGATGTCATCATTACTGTCGGGCGTGAAGGCGCTTTGGAATTAATGGAGGGTATTCCACTC
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail