Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7113
Gene name
LocationContig_8:3679..4545
Strand-
Gene length (bp)866
Transcript length (bp)777
Coding sequence length (bp)777
Protein length (aa) 259

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13398 Peptidase_M50B Peptidase M50B-like 1.9E-59 31 232

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 92 114 22
3 119 141 22
4 146 168 22
5 173 190 17
6 219 241 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7113
MNQDQQQQQQLVARNLQHPTHTQQVTLGVIAGYVVLIAILWNVPYLRMVLWPFKMLVIAFHEFGHASTAMLTGGR
VKSISLDPNEGGVTHLQGGISAITLPAGYLGSSIIGALLTFCGFNIVASKVASFVLGVCFLLTLWWGKRDWLTVL
TVLLAVGLLVACWFIVHAEALRFVVLFIGVMSSLYSVWDICDDLILRKVNSSDASVFAKRYGGSSQCWGVIWSII
SIFVMALGIIAGLAAFSQSFEQQQQDSMHFIPT*
Coding >OphauG2|7113
ATGAACCAGGACCAGCAGCAGCAACAGCAGCTCGTTGCGCGCAATCTTCAGCACCCGACGCACACGCAGCAGGTG
ACGCTGGGCGTTATTGCGGGCTATGTCGTCTTGATTGCCATTTTATGGAACGTGCCCTATCTCCGAATGGTGCTC
TGGCCCTTCAAGATGCTCGTCATTGCCTTTCACGAATTCGGCCACGCGTCAACCGCCATGCTCACTGGCGGCCGC
GTCAAGTCGATTAGCCTCGACCCCAACGAGGGCGGCGTCACCCATCTCCAGGGCGGCATCAGCGCAATCACCCTG
CCCGCCGGCTACCTTGGCTCCTCCATCATTGGCGCCCTGCTCACCTTTTGCGGCTTCAACATTGTCGCCTCAAAG
GTGGCCAGCTTTGTCCTTGGCGTCTGCTTCCTCCTCACCCTGTGGTGGGGGAAGCGCGATTGGCTCACCGTCTTG
ACCGTTTTGCTCGCCGTTGGCCTGCTCGTTGCCTGCTGGTTCATTGTCCACGCCGAGGCCCTGCGCTTTGTCGTG
CTCTTTATTGGCGTCATGTCCTCGCTCTATAGCGTCTGGGACATTTGCGACGATCTCATTCTGCGCAAGGTCAAT
TCCTCGGATGCCAGCGTCTTTGCCAAGCGCTATGGCGGCTCCTCCCAGTGCTGGGGCGTCATTTGGTCCATTATT
TCCATTTTCGTCATGGCCCTGGGCATTATTGCTGGCCTTGCTGCCTTTTCCCAGTCGTTTGAGCAGCAACAGCAG
GACTCGATGCATTTTATCCCTACTTGA
Transcript >OphauG2|7113
ATGAACCAGGACCAGCAGCAGCAACAGCAGCTCGTTGCGCGCAATCTTCAGCACCCGACGCACACGCAGCAGGTG
ACGCTGGGCGTTATTGCGGGCTATGTCGTCTTGATTGCCATTTTATGGAACGTGCCCTATCTCCGAATGGTGCTC
TGGCCCTTCAAGATGCTCGTCATTGCCTTTCACGAATTCGGCCACGCGTCAACCGCCATGCTCACTGGCGGCCGC
GTCAAGTCGATTAGCCTCGACCCCAACGAGGGCGGCGTCACCCATCTCCAGGGCGGCATCAGCGCAATCACCCTG
CCCGCCGGCTACCTTGGCTCCTCCATCATTGGCGCCCTGCTCACCTTTTGCGGCTTCAACATTGTCGCCTCAAAG
GTGGCCAGCTTTGTCCTTGGCGTCTGCTTCCTCCTCACCCTGTGGTGGGGGAAGCGCGATTGGCTCACCGTCTTG
ACCGTTTTGCTCGCCGTTGGCCTGCTCGTTGCCTGCTGGTTCATTGTCCACGCCGAGGCCCTGCGCTTTGTCGTG
CTCTTTATTGGCGTCATGTCCTCGCTCTATAGCGTCTGGGACATTTGCGACGATCTCATTCTGCGCAAGGTCAAT
TCCTCGGATGCCAGCGTCTTTGCCAAGCGCTATGGCGGCTCCTCCCAGTGCTGGGGCGTCATTTGGTCCATTATT
TCCATTTTCGTCATGGCCCTGGGCATTATTGCTGGCCTTGCTGCCTTTTCCCAGTCGTTTGAGCAGCAACAGCAG
GACTCGATGCATTTTATCCCTACTTGA
Gene >OphauG2|7113
ATGAACCAGGACCAGCAGCAGCAACAGCAGCTCGTTGCGCGCAATCTTCAGCACCCGACGCACACGCAGCAGGTG
ACGCTGGGCGTTATTGCGGGCTATGTCGTCTTGATTGCCATTTTATGGAACGTGCCCTATCTCCGAATGGTGCTC
TGGCCCTTCAAGGTGACTAGAACCACGATGCCAAAAAAAAAAAAAAAAAAAAAAACTCTACAAAAAGAACAATAC
ACATATGCTCATGGACATGTTGCTAGATGCTCGTCATTGCCTTTCACGAATTCGGCCACGCGTCAACCGCCATGC
TCACTGGCGGCCGCGTCAAGTCGATTAGCCTCGACCCCAACGAGGGCGGCGTCACCCATCTCCAGGGCGGCATCA
GCGCAATCACCCTGCCCGCCGGCTACCTTGGCTCCTCCATCATTGGCGCCCTGCTCACCTTTTGCGGCTTCAACA
TTGTCGCCTCAAAGGTGGCCAGCTTTGTCCTTGGCGTCTGCTTCCTCCTCACCCTGTGGTGGGGGAAGCGCGATT
GGCTCACCGTCTTGACCGTTTTGCTCGCCGTTGGCCTGCTCGTTGCCTGCTGGTTCATTGTCCACGCCGAGGCCC
TGCGCTTTGTCGTGCTCTTTATTGGCGTCATGTCCTCGCTCTATAGCGTCTGGGACATTTGCGACGATCTCATTC
TGCGCAAGGTCAATTCCTCGGATGCCAGCGTCTTTGCCAAGCGCTATGGCGGCTCCTCCCAGTGCTGGGGCGTCA
TTTGGTCCATTATTTCCATTTTCGTCATGGCCCTGGGCATTATTGCTGGCCTTGCTGCCTTTTCCCAGTCGTTTG
AGCAGCAACAGCAGGACTCGATGCATTTTATCCCTACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail