Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7110
Gene name
LocationContig_798:7369..8639
Strand-
Gene length (bp)1270
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 1.6E-17 155 355

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 17 377 2.0E-74
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 17 363 9.0E-74
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 67 350 5.0E-22
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 67 350 3.0E-20
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 216 365 1.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 17 377 2.0E-74
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 17 363 9.0E-74
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 67 350 5.0E-22
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 67 350 3.0E-20
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 216 365 1.0E-15
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 216 365 1.0E-14
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 216 365 1.0E-14
sp|B0CN39|SFMM3_STRLA O-methyltransferase SfmM3 OS=Streptomyces lavendulae GN=sfmM3 PE=3 SV=1 214 356 2.0E-14
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 30 362 3.0E-14
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 182 360 2.0E-12
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 86 376 3.0E-12
sp|P93324|CHOMT_MEDSA Isoliquiritigenin 2'-O-methyltransferase OS=Medicago sativa PE=1 SV=1 216 360 1.0E-11
sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 90 368 6.0E-11
sp|Q86I40|OMT4_DICDI O-methyltransferase 4 OS=Dictyostelium discoideum GN=omt4 PE=3 SV=1 216 356 7.0E-11
sp|Q84HC8|NCSB1_STRCZ 2,7-dihydroxy-5-methyl-1-naphthoate 7-O-methyltransferase OS=Streptomyces carzinostaticus GN=ncsB1 PE=1 SV=1 259 372 9.0E-11
sp|Q39522|SMT_COPJA (S)-scoulerine 9-O-methyltransferase OS=Coptis japonica GN=SMT PE=1 SV=1 216 355 1.0E-10
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 146 376 1.0E-10
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 216 355 2.0E-10
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 73 356 3.0E-10
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 48 350 4.0E-10
sp|Q9LEL6|6OMT_COPJA (RS)-norcoclaurine 6-O-methyltransferase OS=Coptis japonica PE=1 SV=1 72 356 5.0E-10
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 54 376 5.0E-10
sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 216 355 7.0E-10
sp|O24305|M3OM1_PEA (+)-6a-hydroxymaackiain 3-O-methyltransferase 1 OS=Pisum sativum GN=HMM1 PE=1 SV=1 216 376 2.0E-09
sp|O22308|7OMT6_MEDSA Isoflavone-7-O-methyltransferase 6 OS=Medicago sativa PE=2 SV=1 90 368 2.0E-09
sp|Q7XB11|4OMT1_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 1 OS=Papaver somniferum GN=4'OMT1 PE=2 SV=1 70 376 3.0E-09
sp|O22309|7OMT9_MEDSA Isoflavone-7-O-methyltransferase 9 OS=Medicago sativa PE=2 SV=1 90 368 4.0E-09
sp|O24529|7OMT8_MEDSA Isoflavone-7-O-methyltransferase 8 OS=Medicago sativa PE=1 SV=1 90 368 6.0E-09
sp|C6TAY1|SOMT2_SOYBN Flavonoid 4'-O-methyltransferase OS=Glycine max PE=1 SV=1 216 367 1.0E-08
sp|P46597|ASMT_HUMAN Acetylserotonin O-methyltransferase OS=Homo sapiens GN=ASMT PE=1 SV=1 96 366 1.0E-08
sp|P10950|ASMT_BOVIN Acetylserotonin O-methyltransferase OS=Bos taurus GN=ASMT PE=1 SV=2 60 361 3.0E-08
sp|Q6WUC2|7OMT_PAPSO (R,S)-reticuline 7-O-methyltransferase OS=Papaver somniferum GN=7OMT PE=1 SV=1 216 355 3.0E-08
sp|Q8HZJ0|ASMT_MACMU Acetylserotonin O-methyltransferase OS=Macaca mulatta GN=ASMT PE=2 SV=1 214 372 4.0E-08
sp|Q92056|ASMT_CHICK Acetylserotonin O-methyltransferase OS=Gallus gallus GN=ASMT PE=2 SV=1 261 361 4.0E-08
sp|Q6T1F6|BMT_AMMMJ Bergaptol O-methyltransferase OS=Ammi majus GN=BMT PE=1 SV=1 87 356 7.0E-08
sp|Q29U70|I4OMT_MEDTR Isoflavone 4'-O-methyltransferase OS=Medicago truncatula GN=HI4'OMT PE=1 SV=1 240 368 8.0E-08
sp|A8J6X1|BMT_GLELI Bergaptol O-methyltransferase OS=Glehnia littoralis GN=BMT PE=1 SV=1 160 356 8.0E-08
sp|Q42653|OMT2_CHRAE Quercetin 3-O-methyltransferase 2 OS=Chrysosplenium americanum GN=OMT2 PE=1 SV=1 216 356 1.0E-07
sp|P59049|OMT1_CHRAE Quercetin 3-O-methyltransferase 1 OS=Chrysosplenium americanum GN=OMT1 PE=1 SV=1 216 356 1.0E-07
sp|A8QW52|OMT1_SORBI Eugenol O-methyltransferase OS=Sorghum bicolor GN=EOMT PE=1 SV=1 215 345 2.0E-07
sp|Q9SWC2|COMT1_EUCGL Caffeic acid 3-O-methyltransferase (Fragment) OS=Eucalyptus globulus GN=COMT1 PE=3 SV=1 216 342 7.0E-07
sp|O04385|IEMT_CLABR (Iso)eugenol O-methyltransferase OS=Clarkia breweri GN=IEMT1 PE=1 SV=2 216 356 1.0E-06
sp|B4XY98|AZIB2_STREG 3-hydroxy-5-methyl-1-naphthoate 3-O-methyltransferase OS=Streptomyces sahachiroi GN=aziB2 PE=1 SV=1 216 344 1.0E-06
sp|O95671|ASML_HUMAN N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens GN=ASMTL PE=1 SV=3 177 360 1.0E-06
sp|P28002|COMT1_MEDSA Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1 216 360 2.0E-06
sp|Q43609|COMT1_PRUDU Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1 216 356 3.0E-06
sp|Q93WU3|CVMT1_OCIBA Chavicol O-methyltransferase OS=Ocimum basilicum GN=CVOMT1 PE=1 SV=1 216 355 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No
GO:0008168 methyltransferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup30
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7767
Ophiocordyceps australis 1348a (Ghana) OphauG2|7346
Ophiocordyceps australis 1348a (Ghana) OphauG2|7110 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|4885
Ophiocordyceps australis 1348a (Ghana) OphauG2|4306
Ophiocordyceps australis 1348a (Ghana) OphauG2|3956
Ophiocordyceps australis 1348a (Ghana) OphauG2|1539
Ophiocordyceps australis 1348a (Ghana) OphauG2|1895
Ophiocordyceps australis 1348a (Ghana) OphauG2|266
Ophiocordyceps australis map64 (Brazil) OphauB2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|1462
Ophiocordyceps australis map64 (Brazil) OphauB2|2012
Ophiocordyceps australis map64 (Brazil) OphauB2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|4564
Ophiocordyceps australis map64 (Brazil) OphauB2|7299
Ophiocordyceps camponoti-rufipedis Ophun1|2861
Ophiocordyceps camponoti-rufipedis Ophun1|2000
Ophiocordyceps subramaniannii Hirsu2|8115
Ophiocordyceps subramaniannii Hirsu2|7926
Ophiocordyceps subramaniannii Hirsu2|6259
Ophiocordyceps subramaniannii Hirsu2|2878
Ophiocordyceps subramaniannii Hirsu2|1201
Ophiocordyceps subramaniannii Hirsu2|11082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7110
MADLVAAQEQLPQKTLDESTRHKLMASLHESAEELETPYDTMLRFLNAGRQVALIKLGGDMQIFTSLAESKTPLS
SAQLAKPTGADPRLVARILRYLAANRLVAQVSRDHFVARRATHAFADPRIEGSMRFFHAVSTPAFHVMPDHLKEV
GYRNESQTCAFQKALDTELGMFPWLKQSPDLLKDFQSLMGVPKEGNCLDVITLDSSVSSQHSGPVLVDVGGNTGQ
QAGRFLAKHPELAGRIVVQDRQEAIKNASDVKGCQFMAHDFFTPQPIKGAKYYYLRAILHNWDDEKASQILANIV
PAMAADSLVLIDETVIADQGAPVWQAGLDLQMFTLFGTAERTTTQWDAILDRAGLRPVAVKGYAPIMGSSVIFAA
PK*
Coding >OphauG2|7110
ATGGCAGATCTCGTCGCGGCCCAAGAACAGCTCCCGCAGAAAACACTCGATGAATCCACCAGACACAAGTTGATG
GCTTCTCTGCATGAATCAGCCGAAGAACTCGAGACGCCATACGACACCATGCTGCGCTTCCTCAATGCTGGCCGC
CAAGTCGCACTCATCAAGCTCGGCGGCGACATGCAAATCTTCACCTCGCTAGCCGAGAGCAAAACCCCTCTCTCT
TCCGCCCAGCTCGCCAAGCCCACCGGTGCTGACCCGCGCCTCGTTGCCCGCATCCTGCGCTACCTTGCCGCCAAC
CGTCTTGTTGCCCAGGTCTCGCGCGACCACTTTGTCGCACGCAGGGCAACGCATGCGTTTGCGGACCCCCGTATC
GAGGGCTCCATGCGCTTCTTCCACGCTGTTAGCACGCCGGCTTTCCACGTGATGCCTGACCATCTCAAGGAGGTG
GGCTATCGGAATGAGAGCCAAACGTGTGCTTTTCAAAAGGCTCTGGACACGGAGCTTGGCATGTTTCCCTGGCTG
AAGCAGTCGCCCGACTTGCTCAAGGACTTCCAGAGCCTCATGGGCGTTCCCAAGGAGGGCAACTGTCTTGACGTG
ATTACGCTGGACAGCTCGGTCAGCAGCCAACACAGCGGCCCGGTCTTGGTGGACGTTGGCGGCAACACTGGCCAG
CAAGCAGGACGCTTCTTGGCCAAGCACCCCGAGCTGGCTGGCCGCATCGTGGTTCAGGACCGCCAAGAGGCAATC
AAGAATGCCTCCGACGTCAAGGGCTGCCAGTTCATGGCCCACGACTTTTTCACCCCCCAGCCCATCAAGGGCGCC
AAATACTACTACTTGAGAGCCATTCTGCACAACTGGGACGACGAAAAGGCGTCGCAAATCCTGGCCAACATTGTG
CCTGCCATGGCTGCCGACTCGCTCGTGCTGATTGACGAAACCGTCATTGCAGACCAGGGAGCGCCCGTGTGGCAA
GCAGGCCTCGATTTGCAAATGTTTACTCTCTTTGGCACCGCCGAGCGCACAACCACCCAGTGGGATGCTATCCTC
GACCGAGCTGGACTGCGCCCAGTGGCCGTCAAGGGATATGCGCCCATCATGGGAAGCTCCGTCATTTTTGCCGCT
CCAAAATAA
Transcript >OphauG2|7110
ATGGCAGATCTCGTCGCGGCCCAAGAACAGCTCCCGCAGAAAACACTCGATGAATCCACCAGACACAAGTTGATG
GCTTCTCTGCATGAATCAGCCGAAGAACTCGAGACGCCATACGACACCATGCTGCGCTTCCTCAATGCTGGCCGC
CAAGTCGCACTCATCAAGCTCGGCGGCGACATGCAAATCTTCACCTCGCTAGCCGAGAGCAAAACCCCTCTCTCT
TCCGCCCAGCTCGCCAAGCCCACCGGTGCTGACCCGCGCCTCGTTGCCCGCATCCTGCGCTACCTTGCCGCCAAC
CGTCTTGTTGCCCAGGTCTCGCGCGACCACTTTGTCGCACGCAGGGCAACGCATGCGTTTGCGGACCCCCGTATC
GAGGGCTCCATGCGCTTCTTCCACGCTGTTAGCACGCCGGCTTTCCACGTGATGCCTGACCATCTCAAGGAGGTG
GGCTATCGGAATGAGAGCCAAACGTGTGCTTTTCAAAAGGCTCTGGACACGGAGCTTGGCATGTTTCCCTGGCTG
AAGCAGTCGCCCGACTTGCTCAAGGACTTCCAGAGCCTCATGGGCGTTCCCAAGGAGGGCAACTGTCTTGACGTG
ATTACGCTGGACAGCTCGGTCAGCAGCCAACACAGCGGCCCGGTCTTGGTGGACGTTGGCGGCAACACTGGCCAG
CAAGCAGGACGCTTCTTGGCCAAGCACCCCGAGCTGGCTGGCCGCATCGTGGTTCAGGACCGCCAAGAGGCAATC
AAGAATGCCTCCGACGTCAAGGGCTGCCAGTTCATGGCCCACGACTTTTTCACCCCCCAGCCCATCAAGGGCGCC
AAATACTACTACTTGAGAGCCATTCTGCACAACTGGGACGACGAAAAGGCGTCGCAAATCCTGGCCAACATTGTG
CCTGCCATGGCTGCCGACTCGCTCGTGCTGATTGACGAAACCGTCATTGCAGACCAGGGAGCGCCCGTGTGGCAA
GCAGGCCTCGATTTGCAAATGTTTACTCTCTTTGGCACCGCCGAGCGCACAACCACCCAGTGGGATGCTATCCTC
GACCGAGCTGGACTGCGCCCAGTGGCCGTCAAGGGATATGCGCCCATCATGGGAAGCTCCGTCATTTTTGCCGCT
CCAAAATAA
Gene >OphauG2|7110
ATGGCAGATCTCGTCGCGGCCCAAGAACAGCTCCCGCAGAAAACACTCGATGAATCCACCAGACACAAGTTGATG
GCTTCTCTGCATGAATCAGCCGAAGAACTCGAGACGCCATACGACACCATGCTGCGCTTCCTCAATGCTGTGAGT
AAAAGCCCCTCGTTATTCTTCATGACAAAGACTCACATTTTTTTCTTCCCACCAGGGCCGCCAAGTCGCACTCAT
CAAGCTCGGCGGCGACATGCAAATCTTCACCTCGCTAGCCGAGAGCAAAACCCCTCTCTCTTCCGCCCAGCTCGC
CAAGCCCACCGGTGCTGACCCGCGCCTCGTTGCCCGCATCCTGCGCTACCTTGCCGCCAACCGTCTTGTTGCCCA
GGTCTCGCGCGACCACTTTGTCGCACGCAGGGCAACGCATGCGTTTGCGGACCCCCGTATCGAGGGCTCCATGCG
CTTCTTCCACGCTGTTAGCACGCCGGCTTTCCACGTGATGCCTGACCATCTCAAGGAGGTGGGCTATCGGAATGA
GAGCCAAACGTGTGCTTTTCAAAAGGCTCTGGACACGGAGCTTGGCATGTTTCCCTGGCTGAAGCAGTCGCCCGA
CTTGCTCAAGGACTTCCAGAGCCTCATGGGCGTTCCCAAGGAGGGCAACTGTCTTGACGTGATTACGCTGGACAG
CTCGGTCAGCAGCCAACACAGCGGCCCGGTCTTGGTGGACGTTGGCGGCAACACTGGCCAGCAAGCAGGACGCTT
CTTGGCCAAGCACCCCGAGCTGGCTGGCCGCATCGTGGTTCAGGACCGCCAAGAGGCAATCAAGAATGCCTCCGA
CGTCAAGGGCTGCCAGTTCATGGCCCACGACTTTTTCACCCCCCAGCCCATCAAGGGTGAGTCTTCCATCAATGA
GATCAATGAGCCGAAACAGGACACACTCGAGCCATTTGCTGACTGACCTGACGCAGGCGCCAAATACTACTACTT
GAGAGCCATTCTGCACAACTGGGACGACGAAAAGGCGTCGCAAATCCTGGCCAACATTGTGCCTGCCATGGCTGC
CGACTCGCTCGTGCTGATTGACGAAACCGTCATTGCAGACCAGGGAGCGCCCGTGTGGCAAGCAGGCCTCGATTT
GCAAATGTTTACTCTCTTTGGCACCGCCGAGCGCACAACCACCCAGTGGGATGCTATCCTCGACCGAGCTGGACT
GCGCCCAGTGGCCGTCAAGGGATATGCGCCCATCATGGGAAGCTCCGTCATTTTTGCCGCTCCAAAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail