Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7106
Gene name
LocationContig_797:606..1729
Strand-
Gene length (bp)1123
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00010 HLH Helix-loop-helix DNA-binding domain 1.1E-11 232 279

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5A1E3|CBF1_CANAL Transcriptional regulator CBF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBF1 PE=1 SV=1 210 327 6.0E-44
sp|Q10186|YAWC_SCHPO Uncharacterized bHLH domain-containing protein C3F10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3F10.12c PE=3 SV=1 204 330 8.0E-38
sp|P17106|CBF1_YEAST Centromere-binding protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBF1 PE=1 SV=2 216 335 6.0E-29
sp|P49379|CBF1_KLULA Centromere-binding protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CBF1 PE=3 SV=2 219 337 2.0E-27
sp|Q07957|USF1_XENBO Upstream stimulatory factor 1 OS=Xenopus borealis GN=usf1 PE=2 SV=1 116 312 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5A1E3|CBF1_CANAL Transcriptional regulator CBF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBF1 PE=1 SV=1 210 327 6.0E-44
sp|Q10186|YAWC_SCHPO Uncharacterized bHLH domain-containing protein C3F10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3F10.12c PE=3 SV=1 204 330 8.0E-38
sp|P17106|CBF1_YEAST Centromere-binding protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBF1 PE=1 SV=2 216 335 6.0E-29
sp|P49379|CBF1_KLULA Centromere-binding protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CBF1 PE=3 SV=2 219 337 2.0E-27
sp|Q07957|USF1_XENBO Upstream stimulatory factor 1 OS=Xenopus borealis GN=usf1 PE=2 SV=1 116 312 1.0E-09
sp|Q6XBT4|USF1_BOVIN Upstream stimulatory factor 1 OS=Bos taurus GN=USF1 PE=2 SV=1 232 318 4.0E-09
sp|O02818|USF1_RABIT Upstream stimulatory factor 1 OS=Oryctolagus cuniculus GN=USF1 PE=2 SV=1 232 318 4.0E-09
sp|P22415|USF1_HUMAN Upstream stimulatory factor 1 OS=Homo sapiens GN=USF1 PE=1 SV=1 232 318 4.0E-09
sp|Q61069|USF1_MOUSE Upstream stimulatory factor 1 OS=Mus musculus GN=Usf1 PE=1 SV=1 232 318 4.0E-09
sp|Q15853|USF2_HUMAN Upstream stimulatory factor 2 OS=Homo sapiens GN=USF2 PE=1 SV=1 232 316 1.0E-08
sp|Q63665|USF2_RAT Upstream stimulatory factor 2 OS=Rattus norvegicus GN=Usf2 PE=1 SV=2 232 316 1.0E-08
sp|Q64705|USF2_MOUSE Upstream stimulatory factor 2 OS=Mus musculus GN=Usf2 PE=1 SV=1 232 316 1.0E-08
sp|Q05B92|TFE3_BOVIN Transcription factor E3 OS=Bos taurus GN=TFE3 PE=2 SV=1 230 286 8.0E-07
sp|Q64092|TFE3_MOUSE Transcription factor E3 OS=Mus musculus GN=Tfe3 PE=1 SV=2 230 286 1.0E-06
sp|P19532|TFE3_HUMAN Transcription factor E3 OS=Homo sapiens GN=TFE3 PE=1 SV=4 230 286 1.0E-06
sp|O88368|MITF_RAT Microphthalmia-associated transcription factor (Fragment) OS=Rattus norvegicus GN=Mitf PE=2 SV=1 230 285 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0005488 binding No
GO:0005515 protein binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7106
MSQQVAKIEADLVSVPGSPGQKRKRDVDSPDGQRTKRTAPPAAMSAETASFIENAIEATHAATASGVSVADFSAL
QQAAAADHTEAPDPAQATSTAQAALGMYPTLHVPTSTEDQFAAQASPEADHGHPPQHHEHSYPGDVAQPEPMMDG
SSLSPHHAEAHDHQHQAMGQQQHSPMEQPQQLVQTAVPSQAQAQPSPQAANGVQSSAHRYSTSPIAQHPKPSVGS
EEWHKMRKDNHKEVERRRRETINEGINELAKIVPGCEKNKGSILQRAVSFITQLKENEQQNIEKWTLEKLLTEQA
ITELSASNDKLKQECERLYRELETWKRVAQNAGLEPPQPNKEETNLGTASS*
Coding >OphauG2|7106
ATGTCGCAGCAGGTTGCAAAGATTGAAGCAGACCTTGTCAGCGTTCCCGGCTCTCCTGGGCAGAAGCGCAAGCGC
GACGTGGATAGCCCCGACGGGCAGCGCACCAAGCGCACCGCTCCGCCGGCGGCCATGTCGGCCGAGACTGCGTCA
TTCATTGAAAATGCGATAGAGGCGACGCATGCCGCGACGGCCAGTGGAGTCAGTGTGGCCGACTTTAGCGCGCTT
CAACAGGCTGCTGCTGCTGACCATACAGAGGCGCCGGATCCTGCTCAGGCTACTAGCACCGCGCAGGCGGCCTTG
GGTATGTATCCCACTCTTCATGTGCCTACATCGACCGAGGATCAGTTTGCCGCGCAGGCATCGCCCGAGGCCGAT
CACGGACACCCGCCACAGCATCACGAGCATAGCTATCCTGGCGATGTGGCGCAGCCCGAGCCCATGATGGATGGT
AGCTCTCTGAGCCCCCATCATGCCGAAGCCCACGACCACCAGCATCAAGCAATGGGCCAGCAGCAGCACTCGCCC
ATGGAGCAACCCCAGCAGCTTGTTCAGACGGCGGTGCCATCACAGGCCCAGGCCCAACCATCGCCCCAGGCAGCC
AACGGTGTGCAATCGTCGGCTCACCGGTATTCCACGTCGCCCATTGCACAACACCCAAAACCCAGTGTCGGATCG
GAGGAATGGCATAAAATGCGCAAAGACAACCACAAGGAAGTGGAGAGGCGACGACGTGAAACCATCAACGAGGGC
ATCAATGAACTGGCCAAGATTGTTCCTGGGTGCGAAAAAAACAAGGGCTCGATACTGCAGCGGGCAGTGAGCTTC
ATTACGCAGCTCAAGGAAAACGAGCAACAAAACATTGAAAAGTGGACGCTGGAAAAGCTGCTCACTGAGCAAGCC
ATTACAGAGCTCAGCGCATCCAATGACAAGCTCAAGCAAGAGTGCGAGCGGCTGTACCGCGAGCTGGAGACGTGG
AAGCGCGTCGCGCAAAACGCTGGTCTGGAACCGCCGCAGCCAAACAAGGAGGAGACGAATCTGGGCACGGCATCA
AGCTAG
Transcript >OphauG2|7106
ATGTCGCAGCAGGTTGCAAAGATTGAAGCAGACCTTGTCAGCGTTCCCGGCTCTCCTGGGCAGAAGCGCAAGCGC
GACGTGGATAGCCCCGACGGGCAGCGCACCAAGCGCACCGCTCCGCCGGCGGCCATGTCGGCCGAGACTGCGTCA
TTCATTGAAAATGCGATAGAGGCGACGCATGCCGCGACGGCCAGTGGAGTCAGTGTGGCCGACTTTAGCGCGCTT
CAACAGGCTGCTGCTGCTGACCATACAGAGGCGCCGGATCCTGCTCAGGCTACTAGCACCGCGCAGGCGGCCTTG
GGTATGTATCCCACTCTTCATGTGCCTACATCGACCGAGGATCAGTTTGCCGCGCAGGCATCGCCCGAGGCCGAT
CACGGACACCCGCCACAGCATCACGAGCATAGCTATCCTGGCGATGTGGCGCAGCCCGAGCCCATGATGGATGGT
AGCTCTCTGAGCCCCCATCATGCCGAAGCCCACGACCACCAGCATCAAGCAATGGGCCAGCAGCAGCACTCGCCC
ATGGAGCAACCCCAGCAGCTTGTTCAGACGGCGGTGCCATCACAGGCCCAGGCCCAACCATCGCCCCAGGCAGCC
AACGGTGTGCAATCGTCGGCTCACCGGTATTCCACGTCGCCCATTGCACAACACCCAAAACCCAGTGTCGGATCG
GAGGAATGGCATAAAATGCGCAAAGACAACCACAAGGAAGTGGAGAGGCGACGACGTGAAACCATCAACGAGGGC
ATCAATGAACTGGCCAAGATTGTTCCTGGGTGCGAAAAAAACAAGGGCTCGATACTGCAGCGGGCAGTGAGCTTC
ATTACGCAGCTCAAGGAAAACGAGCAACAAAACATTGAAAAGTGGACGCTGGAAAAGCTGCTCACTGAGCAAGCC
ATTACAGAGCTCAGCGCATCCAATGACAAGCTCAAGCAAGAGTGCGAGCGGCTGTACCGCGAGCTGGAGACGTGG
AAGCGCGTCGCGCAAAACGCTGGTCTGGAACCGCCGCAGCCAAACAAGGAGGAGACGAATCTGGGCACGGCATCA
AGCTAG
Gene >OphauG2|7106
ATGTCGCAGCAGGTTGCAAAGATTGAAGCAGACCTTGTCAGCGTTCCCGGCTCTCCTGGGCAGAAGCGCAAGCGC
GACGTGGATAGCCCCGACGGGCAGCGCACCAAGCGCACCGCTCCGCCGGCGGCCATGTCGGCCGAGACTGCGTCA
TTCATTGAAAATGCGATAGAGGCGACGCATGCCGCGACGGCCAGTGGAGTCAGTGTGGCCGACTTTAGCGCGCTT
CAACAGGCTGCTGCTGCTGACCATACAGAGGCGCCGGATCCTGCTCAGGCTACTAGCACCGCGCAGGCGGCCTTG
GGTATGTATCCCACTCTTCATGTGCCTACATCGACCGAGGATCAGTTTGCCGCGCAGGCATCGCCCGAGGCCGAT
CACGGACACCCGCCACAGCATCACGAGCATAGCTATCCTGGCGATGTGGCGCAGCCCGAGCCCATGATGGATGGT
AGCTCTCTGAGCCCCCATCATGCCGAAGCCCACGACCACCAGCATCAAGCAATGGGCCAGCAGCAGCACTCGCCC
ATGGAGCAACCCCAGCAGCTTGTTCAGACGGCGGTGCCATCACAGGCCCAGGCCCAACCATCGCCCCAGGCAGCC
AACGGTGTGCAATCGTCGGCTCACCGGTATTCCACGTCGCCCATTGCACAACACCCAAAACCCAGTGTCGGATCG
GAGGAATGGCATAAAATGCGCAAAGACAACCACAAGGAAGGTGAGATGGCAGCCCCCTCCCCCCCCCTCTTGTTG
GCGGAGCTCAAGCTTACTTTGCTTGGCTGTAGTGGAGAGGCGACGACGTGAAACCATCAACGAGGGCATCAATGA
ACTGGCCAAGATTGTTCCTGGGTGCGAAAAAAACAAGGGCTCGATACTGCAGCGGGCAGTGAGCTTCATTACGCA
GCTCAAGGAAAACGAGCAACAAAACATTGAAAAGTGGACGCTGGAAAAGCTGCTCACTGAGCAAGCCATTACAGA
GCTCAGCGCATCCAATGACAAGCTCAAGCAAGAGTGCGAGCGGCTGTACCGCGAGCTGGAGACGTGGAAGCGCGT
CGCGCAAAACGCTGGTCTGGAACCGCCGCAGCCAAACAAGGAGGAGACGAATCTGGGCACGGCATCAAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail