Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7096
Gene name
LocationContig_794:645..2691
Strand+
Gene length (bp)2046
Transcript length (bp)1908
Coding sequence length (bp)1908
Protein length (aa) 636

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain 1.5E-07 63 119
PF03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain 5.6E-29 143 266
PF00984 UDPG_MGDP_dh UDP-glucose/GDP-mannose dehydrogenase family, central domain 1.8E-31 289 383
PF03720 UDPG_MGDP_dh_C UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain 6.5E-18 408 495

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LIA8|UGDH2_ARATH UDP-glucose 6-dehydrogenase 2 OS=Arabidopsis thaliana GN=UGD2 PE=1 SV=1 37 494 3.0E-143
sp|Q9FM01|UGDH4_ARATH UDP-glucose 6-dehydrogenase 4 OS=Arabidopsis thaliana GN=UGD4 PE=1 SV=1 37 494 3.0E-143
sp|O02373|UGDH_DROME UDP-glucose 6-dehydrogenase OS=Drosophila melanogaster GN=sgl PE=1 SV=1 37 492 5.0E-143
sp|Q9LF33|UGDH3_ARATH UDP-glucose 6-dehydrogenase 3 OS=Arabidopsis thaliana GN=UGD3 PE=1 SV=1 37 493 1.0E-141
sp|Q96558|UGDH1_SOYBN UDP-glucose 6-dehydrogenase 1 OS=Glycine max GN=UGD1 PE=2 SV=1 37 493 4.0E-141
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LIA8|UGDH2_ARATH UDP-glucose 6-dehydrogenase 2 OS=Arabidopsis thaliana GN=UGD2 PE=1 SV=1 37 494 3.0E-143
sp|Q9FM01|UGDH4_ARATH UDP-glucose 6-dehydrogenase 4 OS=Arabidopsis thaliana GN=UGD4 PE=1 SV=1 37 494 3.0E-143
sp|O02373|UGDH_DROME UDP-glucose 6-dehydrogenase OS=Drosophila melanogaster GN=sgl PE=1 SV=1 37 492 5.0E-143
sp|Q9LF33|UGDH3_ARATH UDP-glucose 6-dehydrogenase 3 OS=Arabidopsis thaliana GN=UGD3 PE=1 SV=1 37 493 1.0E-141
sp|Q96558|UGDH1_SOYBN UDP-glucose 6-dehydrogenase 1 OS=Glycine max GN=UGD1 PE=2 SV=1 37 493 4.0E-141
sp|Q75GS4|UGDH1_ORYSJ UDP-glucose 6-dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=UGD1 PE=3 SV=1 37 494 1.0E-140
sp|Q2QS13|UGDH5_ORYSJ UDP-glucose 6-dehydrogenase 5 OS=Oryza sativa subsp. japonica GN=UGD5 PE=2 SV=1 37 493 3.0E-140
sp|Q2QS14|UGDH4_ORYSJ UDP-glucose 6-dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=UGD4 PE=2 SV=1 37 493 1.0E-139
sp|Q9AUV6|UGDH3_ORYSJ UDP-glucose 6-dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=UGD3 PE=2 SV=1 37 493 2.0E-139
sp|Q9FZE1|UGDH1_ARATH UDP-glucose 6-dehydrogenase 1 OS=Arabidopsis thaliana GN=UGD1 PE=2 SV=1 37 494 2.0E-139
sp|P12378|UGDH_BOVIN UDP-glucose 6-dehydrogenase OS=Bos taurus GN=UGDH PE=1 SV=2 33 493 9.0E-139
sp|Q5R7B3|UGDH_PONAB UDP-glucose 6-dehydrogenase OS=Pongo abelii GN=UGDH PE=2 SV=1 33 493 6.0E-138
sp|O60701|UGDH_HUMAN UDP-glucose 6-dehydrogenase OS=Homo sapiens GN=UGDH PE=1 SV=1 33 493 1.0E-137
sp|O70475|UGDH_MOUSE UDP-glucose 6-dehydrogenase OS=Mus musculus GN=Ugdh PE=1 SV=1 32 493 4.0E-137
sp|O70199|UGDH_RAT UDP-glucose 6-dehydrogenase OS=Rattus norvegicus GN=Ugdh PE=1 SV=1 32 493 5.0E-137
sp|Q5F3T9|UGDH_CHICK UDP-glucose 6-dehydrogenase OS=Gallus gallus GN=UGDH PE=2 SV=1 33 493 2.0E-136
sp|B7F958|UGDH2_ORYSJ UDP-glucose 6-dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=UGD2 PE=2 SV=1 37 493 3.0E-134
sp|Q19905|UGDH_CAEEL UDP-glucose 6-dehydrogenase OS=Caenorhabditis elegans GN=sqv-4 PE=1 SV=1 33 492 1.0E-133
sp|O32271|TUAD_BACSU UDP-glucose 6-dehydrogenase TuaD OS=Bacillus subtilis (strain 168) GN=tuaD PE=1 SV=1 34 493 1.0E-60
sp|O86422|UDG_PSEAE UDP-glucose 6-dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=udg PE=3 SV=2 37 496 5.0E-58
sp|O05973|UDG_RICPR UDP-glucose 6-dehydrogenase OS=Rickettsia prowazekii (strain Madrid E) GN=udg PE=3 SV=1 36 493 5.0E-55
sp|O54068|UDG_RHIME UDP-glucose 6-dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=rkpK PE=3 SV=2 37 493 6.0E-54
sp|Q4UK39|UDG_RICFE UDP-glucose 6-dehydrogenase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=udg PE=3 SV=1 36 493 8.0E-54
sp|Q68VX0|UDG_RICTY UDP-glucose 6-dehydrogenase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=udg PE=3 SV=1 36 493 1.0E-53
sp|Q92GB1|UDG_RICCN UDP-glucose 6-dehydrogenase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=udg PE=3 SV=1 36 493 3.0E-52
sp|O34862|YTCA_BACSU Putative UDP-glucose 6-dehydrogenase YtcA OS=Bacillus subtilis (strain 168) GN=ytcA PE=3 SV=1 37 492 9.0E-51
sp|P96718|YWQF_BACSU UDP-glucose 6-dehydrogenase YwqF OS=Bacillus subtilis (strain 168) GN=ywqF PE=1 SV=1 37 499 3.0E-50
sp|Q1RKF8|UDG_RICBR UDP-glucose 6-dehydrogenase OS=Rickettsia bellii (strain RML369-C) GN=udg PE=3 SV=1 37 493 2.0E-49
sp|D4GYH5|AGLM_HALVD UDP-glucose 6-dehydrogenase AglM OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aglM PE=1 SV=1 37 448 1.0E-36
sp|Q58454|Y1054_METJA Uncharacterized protein MJ1054 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1054 PE=3 SV=1 36 355 4.0E-32
sp|A6VK13|WECC_METM7 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=wecC PE=3 SV=1 30 494 1.0E-23
sp|P11759|ALGD_PSEAE GDP-mannose 6-dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=algD PE=1 SV=2 56 444 1.0E-22
sp|P59793|ALGD_PSESY GDP-mannose 6-dehydrogenase OS=Pseudomonas syringae pv. syringae GN=algD PE=3 SV=1 56 500 5.0E-22
sp|Q6LZC3|WECC_METMP UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=wecC PE=1 SV=1 30 450 1.0E-21
sp|O07299|ALGD_PSESH GDP-mannose 6-dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola GN=algD PE=3 SV=1 56 500 1.0E-21
sp|P58591|EPSD_RALSO NDP-N-acetyl-D-galactosaminuronic acid dehydrogenase OS=Ralstonia solanacearum (strain GMI1000) GN=epsD PE=3 SV=1 32 445 2.0E-21
sp|A6USK4|WECC_METVS UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=wecC PE=3 SV=1 33 493 3.0E-21
sp|Q887P8|ALGD_PSESM GDP-mannose 6-dehydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=algD PE=2 SV=1 56 500 4.0E-21
sp|Q45410|EPSD_RALSL NDP-N-acetyl-D-galactosaminuronic acid dehydrogenase OS=Ralstonia solanacearum GN=epsD PE=3 SV=1 32 445 4.0E-21
sp|Q8Z389|WECC_SALTI UDP-N-acetyl-D-mannosamine dehydrogenase OS=Salmonella typhi GN=wecC PE=3 SV=1 36 445 5.0E-20
sp|A4FY94|WECC_METM5 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=wecC PE=3 SV=1 30 494 6.0E-20
sp|A6UU98|WECC_META3 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=wecC PE=3 SV=1 33 494 6.0E-20
sp|Q47329|UDG5_ECOLX UDP-glucose 6-dehydrogenase OS=Escherichia coli GN=kfiD PE=3 SV=1 139 447 7.0E-20
sp|P67067|WECC_SHIFL UDP-N-acetyl-D-mannosamine dehydrogenase OS=Shigella flexneri GN=wecC PE=3 SV=1 36 445 8.0E-20
sp|P27829|WECC_ECOLI UDP-N-acetyl-D-mannosamine dehydrogenase OS=Escherichia coli (strain K12) GN=wecC PE=1 SV=4 36 445 8.0E-20
sp|P67066|WECC_ECO57 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Escherichia coli O157:H7 GN=wecC PE=3 SV=1 36 445 8.0E-20
sp|P51585|ALGD_AZOVI GDP-mannose 6-dehydrogenase OS=Azotobacter vinelandii GN=algD PE=3 SV=1 78 444 1.0E-19
sp|Q88NC4|ALGD_PSEPK GDP-mannose 6-dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=algD PE=3 SV=1 78 501 1.0E-19
sp|Q8ZAE4|WECC_YERPE UDP-N-acetyl-D-mannosamine dehydrogenase OS=Yersinia pestis GN=wecC PE=3 SV=1 36 445 4.0E-19
sp|O33952|UDG8_ECOLX UDP-glucose 6-dehydrogenase OS=Escherichia coli GN=ugd PE=3 SV=1 139 447 4.0E-19
sp|P76373|UDG_ECOLI UDP-glucose 6-dehydrogenase OS=Escherichia coli (strain K12) GN=ugd PE=1 SV=1 152 447 1.0E-18
sp|Q9L6R4|WECC_SALTY UDP-N-acetyl-D-mannosamine dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=wecC PE=3 SV=1 36 445 1.0E-18
sp|Q7DBF9|UDG_ECO57 UDP-glucose 6-dehydrogenase OS=Escherichia coli O157:H7 GN=ugd PE=3 SV=1 152 447 1.0E-18
sp|Q8FG45|UDG_ECOL6 UDP-glucose 6-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ugd PE=3 SV=1 152 447 2.0E-18
sp|Q04872|UDG_ECO11 UDP-glucose 6-dehydrogenase OS=Escherichia coli O111:H- GN=ugd PE=3 SV=1 139 447 3.0E-18
sp|Q04873|UDG_SALTY UDP-glucose 6-dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=udg PE=3 SV=1 139 446 2.0E-17
sp|P37791|UDG_SHIFL Putative UDP-glucose 6-dehydrogenase OS=Shigella flexneri GN=udg PE=5 SV=1 152 411 2.0E-17
sp|P0DG69|UDG_STRPQ UDP-glucose 6-dehydrogenase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=hasB PE=3 SV=1 139 450 3.0E-17
sp|P0DG68|UDG_STRP3 UDP-glucose 6-dehydrogenase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=hasB PE=3 SV=1 152 450 6.0E-17
sp|P0C0F4|UDG_STRPY UDP-glucose 6-dehydrogenase OS=Streptococcus pyogenes GN=hasB PE=1 SV=1 152 450 6.0E-17
sp|Q8NKX0|UDG_STRP8 UDP-glucose 6-dehydrogenase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=hasB PE=3 SV=1 152 450 6.0E-17
sp|Q5X9A8|UDG_STRP6 UDP-glucose 6-dehydrogenase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=hasB PE=3 SV=1 152 450 6.0E-17
sp|P0C0F5|UDG_STRP1 UDP-glucose 6-dehydrogenase OS=Streptococcus pyogenes serotype M1 GN=hasB PE=3 SV=1 152 450 1.0E-16
sp|Q57871|WECC_METJA UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=wecC PE=3 SV=1 35 494 2.0E-13
sp|Q57346|UDG_STREE UDP-glucose 6-dehydrogenase OS=Streptococcus pneumoniae GN=cap3A PE=3 SV=2 185 451 7.0E-13
sp|G3XD94|UGND_PSEAE UDP-N-acetyl-D-glucosamine 6-dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=wbpA PE=1 SV=1 152 492 1.0E-10
sp|Q04972|VIPA_SALTI Vi polysaccharide biosynthesis protein VipA/TviB OS=Salmonella typhi GN=vipA PE=3 SV=1 149 493 3.0E-09
sp|P39861|CAPL_STAAU Protein CapL OS=Staphylococcus aureus GN=capL PE=3 SV=1 35 434 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0051287 NAD binding Yes
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup389
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7096 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2200
Ophiocordyceps camponoti-floridani Ophcf2|05510
Ophiocordyceps camponoti-rufipedis Ophun1|1762
Ophiocordyceps camponoti-rufipedis Ophun1|1852
Ophiocordyceps kimflemingae Ophio5|1212
Ophiocordyceps kimflemingae Ophio5|7909
Ophiocordyceps subramaniannii Hirsu2|1665
Ophiocordyceps subramaniannii Hirsu2|5259

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7096
MTSIPEAVVDSVRKLGLNGSSQDANGAFDGHVEVRTICCVGAGYVGKPAWSPASVIFMLMATGGPTAAVVAFQNP
HIKVTVVDRDEYRIRRWNSRHPPIYEPGLHDIVRIARDGGRQTAFSNEPCSDSDDEQHQANAGETTMACRPGNLF
FTTDVAAGIREADLVLVAVNTPTKERGVGAGSATDMTAFEAVTAVVAQYAREGAIIVEKSTVPCRTAQLLSMHRP
GVHFEILSNPEFLAAGTAVNDLLYPDRILIGSAPTPSGKRAAEALVDVYASWVPRNRILTTNVWSSELAKLVANS
MLAQRISSINSISAVCEQTGADVDEVSRAIGVDPRIGNKFLMAGIGFGGSCFKKDVLNLVYLADTMGLPEVGEYW
RQVVKMNEYARDRFTNRVIKCLNNTLVGKKVTILGYAFKKNTSDTREAPALEMIKTLLEERPREVAVFDPCCNPF
VIKEEIRAAIGPLVNSVSVYSNAYDACRDSTAVVIATEFDEFRNQPAPAPAPVSQPAGRKPNPKSDPRPFTSTQP
SESEWLSLHKYLVQRPEETSDDPLHRLNKEPLCGPDCPDCIQERESQKTGVASGMGSAEEYRAKERLNWNYIADT
MAKPRWVFDGRGVIDSREMVKLGVRVESVGRQHRF*
Coding >OphauG2|7096
ATGACATCGATTCCAGAGGCTGTTGTCGACTCGGTGCGCAAATTGGGGCTCAATGGCTCCTCGCAAGACGCCAAT
GGGGCGTTTGATGGCCACGTCGAGGTGCGCACCATCTGCTGCGTCGGTGCGGGTTATGTTGGTAAGCCGGCCTGG
TCCCCTGCATCCGTCATTTTTATGCTCATGGCAACAGGCGGCCCTACTGCAGCCGTTGTGGCCTTTCAAAACCCT
CACATCAAGGTGACTGTTGTCGACCGCGACGAGTACCGCATCCGCCGCTGGAACTCGCGCCATCCTCCAATCTAC
GAGCCCGGCCTGCATGACATTGTCCGCATTGCCCGCGACGGCGGCCGCCAAACCGCCTTTTCCAACGAGCCGTGC
TCCGACTCGGACGATGAACAGCACCAAGCCAATGCCGGCGAAACCACCATGGCCTGCCGTCCCGGCAATCTCTTC
TTCACTACCGACGTTGCCGCTGGCATCCGCGAGGCCGATCTTGTGCTTGTGGCGGTCAATACGCCTACAAAGGAA
CGCGGTGTTGGTGCTGGCAGCGCAACAGACATGACGGCTTTTGAGGCTGTCACGGCTGTTGTGGCGCAATACGCA
CGCGAAGGCGCCATTATAGTTGAGAAGAGCACTGTCCCCTGTCGCACTGCGCAGCTGCTCTCAATGCATCGACCT
GGCGTTCACTTCGAGATTCTTTCAAACCCCGAGTTCCTGGCTGCTGGGACAGCAGTCAATGACCTCCTCTACCCC
GATCGTATTCTCATTGGCTCTGCACCCACCCCCTCGGGCAAAAGGGCTGCGGAAGCTCTGGTTGACGTGTACGCT
TCGTGGGTGCCTCGGAACCGCATCTTGACGACGAATGTATGGTCGTCGGAGCTTGCCAAGCTTGTGGCCAACTCG
ATGCTTGCGCAGCGAATATCTAGCATCAATTCCATCTCGGCCGTGTGCGAACAGACTGGCGCCGATGTCGACGAG
GTGTCGCGCGCCATTGGCGTGGACCCTCGCATCGGCAACAAGTTTCTTATGGCTGGTATTGGCTTTGGCGGCAGC
TGCTTCAAAAAGGATGTTCTCAATCTGGTCTACCTTGCCGACACCATGGGCCTGCCCGAAGTGGGCGAATACTGG
CGTCAGGTGGTCAAGATGAATGAGTATGCTCGGGATCGCTTCACCAACCGCGTCATCAAGTGTCTCAACAACACG
TTGGTGGGCAAAAAGGTGACGATTCTGGGCTATGCCTTCAAGAAGAATACGTCGGACACGCGCGAGGCGCCGGCC
CTAGAGATGATCAAGACGCTTCTCGAGGAGCGTCCGCGGGAAGTGGCCGTGTTTGATCCTTGCTGCAATCCCTTT
GTTATCAAGGAGGAGATTAGGGCGGCTATTGGCCCCCTCGTCAACAGCGTCTCGGTCTACAGCAATGCCTATGAT
GCGTGCCGGGACAGTACTGCCGTGGTTATTGCTACCGAGTTTGACGAGTTCCGTAACCAGCCGGCTCCGGCCCCG
GCGCCCGTTTCTCAGCCGGCTGGCCGCAAGCCCAACCCCAAGTCGGATCCGCGGCCGTTTACGTCGACACAGCCC
AGCGAGAGCGAATGGCTGTCATTGCACAAATACTTGGTGCAGCGCCCCGAGGAAACGTCGGACGATCCGCTGCAC
CGACTCAACAAGGAGCCGTTGTGCGGGCCTGACTGTCCCGACTGTATCCAGGAACGAGAGAGCCAGAAGACTGGA
GTGGCGAGTGGCATGGGTAGTGCCGAGGAATACCGTGCCAAGGAGCGGCTCAACTGGAACTACATCGCCGACACC
ATGGCGAAGCCGCGGTGGGTATTTGACGGCAGAGGGGTGATTGACTCGCGCGAAATGGTCAAGCTGGGTGTGCGG
GTGGAAAGTGTTGGACGGCAACATCGCTTCTAA
Transcript >OphauG2|7096
ATGACATCGATTCCAGAGGCTGTTGTCGACTCGGTGCGCAAATTGGGGCTCAATGGCTCCTCGCAAGACGCCAAT
GGGGCGTTTGATGGCCACGTCGAGGTGCGCACCATCTGCTGCGTCGGTGCGGGTTATGTTGGTAAGCCGGCCTGG
TCCCCTGCATCCGTCATTTTTATGCTCATGGCAACAGGCGGCCCTACTGCAGCCGTTGTGGCCTTTCAAAACCCT
CACATCAAGGTGACTGTTGTCGACCGCGACGAGTACCGCATCCGCCGCTGGAACTCGCGCCATCCTCCAATCTAC
GAGCCCGGCCTGCATGACATTGTCCGCATTGCCCGCGACGGCGGCCGCCAAACCGCCTTTTCCAACGAGCCGTGC
TCCGACTCGGACGATGAACAGCACCAAGCCAATGCCGGCGAAACCACCATGGCCTGCCGTCCCGGCAATCTCTTC
TTCACTACCGACGTTGCCGCTGGCATCCGCGAGGCCGATCTTGTGCTTGTGGCGGTCAATACGCCTACAAAGGAA
CGCGGTGTTGGTGCTGGCAGCGCAACAGACATGACGGCTTTTGAGGCTGTCACGGCTGTTGTGGCGCAATACGCA
CGCGAAGGCGCCATTATAGTTGAGAAGAGCACTGTCCCCTGTCGCACTGCGCAGCTGCTCTCAATGCATCGACCT
GGCGTTCACTTCGAGATTCTTTCAAACCCCGAGTTCCTGGCTGCTGGGACAGCAGTCAATGACCTCCTCTACCCC
GATCGTATTCTCATTGGCTCTGCACCCACCCCCTCGGGCAAAAGGGCTGCGGAAGCTCTGGTTGACGTGTACGCT
TCGTGGGTGCCTCGGAACCGCATCTTGACGACGAATGTATGGTCGTCGGAGCTTGCCAAGCTTGTGGCCAACTCG
ATGCTTGCGCAGCGAATATCTAGCATCAATTCCATCTCGGCCGTGTGCGAACAGACTGGCGCCGATGTCGACGAG
GTGTCGCGCGCCATTGGCGTGGACCCTCGCATCGGCAACAAGTTTCTTATGGCTGGTATTGGCTTTGGCGGCAGC
TGCTTCAAAAAGGATGTTCTCAATCTGGTCTACCTTGCCGACACCATGGGCCTGCCCGAAGTGGGCGAATACTGG
CGTCAGGTGGTCAAGATGAATGAGTATGCTCGGGATCGCTTCACCAACCGCGTCATCAAGTGTCTCAACAACACG
TTGGTGGGCAAAAAGGTGACGATTCTGGGCTATGCCTTCAAGAAGAATACGTCGGACACGCGCGAGGCGCCGGCC
CTAGAGATGATCAAGACGCTTCTCGAGGAGCGTCCGCGGGAAGTGGCCGTGTTTGATCCTTGCTGCAATCCCTTT
GTTATCAAGGAGGAGATTAGGGCGGCTATTGGCCCCCTCGTCAACAGCGTCTCGGTCTACAGCAATGCCTATGAT
GCGTGCCGGGACAGTACTGCCGTGGTTATTGCTACCGAGTTTGACGAGTTCCGTAACCAGCCGGCTCCGGCCCCG
GCGCCCGTTTCTCAGCCGGCTGGCCGCAAGCCCAACCCCAAGTCGGATCCGCGGCCGTTTACGTCGACACAGCCC
AGCGAGAGCGAATGGCTGTCATTGCACAAATACTTGGTGCAGCGCCCCGAGGAAACGTCGGACGATCCGCTGCAC
CGACTCAACAAGGAGCCGTTGTGCGGGCCTGACTGTCCCGACTGTATCCAGGAACGAGAGAGCCAGAAGACTGGA
GTGGCGAGTGGCATGGGTAGTGCCGAGGAATACCGTGCCAAGGAGCGGCTCAACTGGAACTACATCGCCGACACC
ATGGCGAAGCCGCGGTGGGTATTTGACGGCAGAGGGGTGATTGACTCGCGCGAAATGGTCAAGCTGGGTGTGCGG
GTGGAAAGTGTTGGACGGCAACATCGCTTCTAA
Gene >OphauG2|7096
ATGACATCGATTCCAGAGGCTGTTGTCGACTCGGTGCGCAAATTGGGGCTCAATGGCTCCTCGCAAGACGCCAAT
GGGGCGTTTGATGGCCACGTCGAGGTGCGCACCATCTGCTGCGTCGGTGCGGGTTATGTTGGTAAGCCGGCCTGG
TCCCCTGCATCCGTCATTTTTATGCTCATGGCAACAGGCGGCCCTACTGCAGCCGTTGTGGCCTTTCAAAACCCT
CACATCAAGGTGACTGTTGTCGACCGCGACGAGTACCGCATCCGCCGCTGGAACTCGCGCCATCCTCCAATCTAC
GAGCCCGGCCTGCATGACATTGTCCGCATTGCCCGCGACGGCGGCCGCCAAACCGCCTTTTCCAACGAGCCGTGC
TCCGACTCGGACGATGAACAGCACCAAGCCAATGCCGGCGAAACCACCATGGCCTGCCGTCCCGGCAATCTCTTC
TTCACTACCGACGTTGCCGCTGGCATCCGCGAGGCCGATCTTGTGCTTGTGGCGGTCAATACGCCTACAAAGGAA
CGCGGTGTTGGTGCTGGCAGCGCAACAGACATGACGGCTTTTGAGGCTGTCACGGCTGTTGTGGCGCAATACGCA
CGCGAAGGCGCCATTATAGTTGAGAAGAGCACTGTCCCCTGTCGCACTGCGCAGCTGGTAGCAGATACGGTAGAG
TCTTTTCTCCCTCTTGTCTCCCTTGTCTCTTTTGCTTTTTTCTTTACTTTCTTTCTCGTTTTATTCTGGTCCCGT
TATTCGTCCGCCTTGCCCATCTGCTGACCCTCTTGCTTGACGTAGCTCTCAATGCATCGACCTGGCGTTCACTTC
GAGATTCTTTCAAACCCCGAGTTCCTGGCTGCTGGGACAGCAGTCAATGACCTCCTCTACCCCGATCGTATTCTC
ATTGGCTCTGCACCCACCCCCTCGGGCAAAAGGGCTGCGGAAGCTCTGGTTGACGTGTACGCTTCGTGGGTGCCT
CGGAACCGCATCTTGACGACGAATGTATGGTCGTCGGAGCTTGCCAAGCTTGTGGCCAACTCGATGCTTGCGCAG
CGAATATCTAGCATCAATTCCATCTCGGCCGTGTGCGAACAGACTGGCGCCGATGTCGACGAGGTGTCGCGCGCC
ATTGGCGTGGACCCTCGCATCGGCAACAAGTTTCTTATGGCTGGTATTGGCTTTGGCGGCAGCTGCTTCAAAAAG
GATGTTCTCAATCTGGTCTACCTTGCCGACACCATGGGCCTGCCCGAAGTGGGCGAATACTGGCGTCAGGTGGTC
AAGATGAATGAGTATGCTCGGGATCGCTTCACCAACCGCGTCATCAAGTGTCTCAACAACACGTTGGTGGGCAAA
AAGGTGACGATTCTGGGCTATGCCTTCAAGAAGAATACGTCGGACACGCGCGAGGCGCCGGCCCTAGAGATGATC
AAGACGCTTCTCGAGGAGCGTCCGCGGGAAGTGGCCGTGTTTGATCCTTGCTGCAATCCCTTTGTTATCAAGGAG
GAGATTAGGGCGGCTATTGGCCCCCTCGTCAACAGCGTCTCGGTCTACAGCAATGCCTATGATGCGTGCCGGGAC
AGTACTGCCGTGGTTATTGCTACCGAGTTTGACGAGTTCCGTAACCAGCCGGCTCCGGCCCCGGCGCCCGTTTCT
CAGCCGGCTGGCCGCAAGCCCAACCCCAAGTCGGATCCGCGGCCGTTTACGTCGACACAGCCCAGCGAGAGCGAA
TGGCTGTCATTGCACAAATACTTGGTGCAGCGCCCCGAGGAAACGTCGGACGATCCGCTGCACCGACTCAACAAG
GAGCCGTTGTGCGGGCCTGACTGTCCCGACTGTATCCAGGAACGAGAGAGCCAGAAGACTGGAGTGGCGAGTGGC
ATGGGTAGTGCCGAGGAATACCGTGCCAAGGAGCGGCTCAACTGGAACTACATCGCCGACACCATGGCGAAGCCG
CGGTGGGTATTTGACGGCAGAGGGGTGATTGACTCGCGCGAAATGGTCAAGCTGGGTGTGCGGGTGGAAAGTGTT
GGACGGCAACATCGCTTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail