Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7089
Gene name
LocationContig_792:4..1587
Strand+
Gene length (bp)1583
Transcript length (bp)1464
Coding sequence length (bp)1464
Protein length (aa) 488

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 2.8E-40 2 312

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15555|DAC_STRSR D-alanyl-D-alanine carboxypeptidase OS=Streptomyces sp. (strain R61) PE=1 SV=2 36 321 8.0E-11
sp|A6WYS5|DAP_OCHA4 D-aminopeptidase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=dap PE=3 SV=1 2 310 2.0E-09
sp|Q8FV99|DAP_BRUSU D-aminopeptidase OS=Brucella suis biovar 1 (strain 1330) GN=dap PE=3 SV=1 5 310 1.0E-08
sp|A9WVV8|DAP_BRUSI D-aminopeptidase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=dap PE=3 SV=1 5 310 1.0E-08
sp|A9MCM7|DAP_BRUC2 D-aminopeptidase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=dap PE=3 SV=1 5 310 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15555|DAC_STRSR D-alanyl-D-alanine carboxypeptidase OS=Streptomyces sp. (strain R61) PE=1 SV=2 36 321 8.0E-11
sp|A6WYS5|DAP_OCHA4 D-aminopeptidase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=dap PE=3 SV=1 2 310 2.0E-09
sp|Q8FV99|DAP_BRUSU D-aminopeptidase OS=Brucella suis biovar 1 (strain 1330) GN=dap PE=3 SV=1 5 310 1.0E-08
sp|A9WVV8|DAP_BRUSI D-aminopeptidase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=dap PE=3 SV=1 5 310 1.0E-08
sp|A9MCM7|DAP_BRUC2 D-aminopeptidase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=dap PE=3 SV=1 5 310 1.0E-08
sp|Q579G4|DAP_BRUAB D-aminopeptidase OS=Brucella abortus biovar 1 (strain 9-941) GN=dap PE=3 SV=1 5 310 1.0E-08
sp|Q2YLB4|DAP_BRUA2 D-aminopeptidase OS=Brucella abortus (strain 2308) GN=dap PE=3 SV=1 5 310 1.0E-08
sp|B2SD81|DAP_BRUA1 D-aminopeptidase OS=Brucella abortus (strain S19) GN=dap PE=3 SV=1 5 310 1.0E-08
sp|C0RM93|DAP_BRUMB D-aminopeptidase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=dap PE=3 SV=1 5 310 2.0E-08
sp|A5VVL2|DAP_BRUO2 D-aminopeptidase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dap PE=3 SV=1 5 310 2.0E-08
sp|O31773|PBPX_BACSU Putative penicillin-binding protein PbpX OS=Bacillus subtilis (strain 168) GN=pbpX PE=2 SV=1 2 291 2.0E-08
sp|Q8YD27|DAP_BRUME D-aminopeptidase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dap PE=3 SV=1 5 310 2.0E-08
sp|Q9ZBA9|DAP_OCHAN D-aminopeptidase OS=Ochrobactrum anthropi GN=dap PE=1 SV=3 5 356 2.0E-07
sp|Q6GDZ1|FLP_STAAR Protein flp OS=Staphylococcus aureus (strain MRSA252) GN=flp PE=3 SV=1 2 310 8.0E-07
sp|Q6G6M9|FLP_STAAS Protein flp OS=Staphylococcus aureus (strain MSSA476) GN=flp PE=3 SV=1 2 310 1.0E-06
sp|Q8NUZ4|FLP_STAAW Protein flp OS=Staphylococcus aureus (strain MW2) GN=flp PE=3 SV=1 2 310 2.0E-06
sp|Q7A3Q5|FLP_STAAN Protein flp OS=Staphylococcus aureus (strain N315) GN=flp PE=1 SV=1 2 310 2.0E-06
sp|Q99RJ0|FLP_STAAM Protein flp OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=flp PE=3 SV=1 2 310 2.0E-06
sp|Q5HDB2|FLP_STAAC Protein flp OS=Staphylococcus aureus (strain COL) GN=flp PE=4 SV=1 2 310 5.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup422
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7089 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7049
Ophiocordyceps camponoti-floridani Ophcf2|01982
Ophiocordyceps camponoti-rufipedis Ophun1|2785
Ophiocordyceps kimflemingae Ophio5|4027
Ophiocordyceps subramaniannii Hirsu2|3858
Ophiocordyceps subramaniannii Hirsu2|5496
Ophiocordyceps subramaniannii Hirsu2|8281

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7089
MSLAVIDGHKVYAKGYGFATLPSTPATPETLWYGASTTKAYIAAAMGHLVDSGEHAQLAKGWDTAIASILRDDFV
LEDEWATNHVTLDDAVSHRSGMTRHDKSCMHMVNGSQASPRDVVRNLRNLPLRREPRVKFSYCNLMYVTLGHALE
RLTGKPVAKLLHDVIWRPLGMKATFLHLHDALQAPQHLASGYWWDDQTDTFKPVEHMHLSELVSAGGIISNVLDY
AQWIKCLIHQQAPFSNRVHADIRRPRIIKDDVSLPGLEFSLYGLGWEHRSYMGHTVLTHNGILDAFGAQVYWLPD
AKFGAVAFANTAWTSNAVQDIVIHGLIRDKLGIRQGDMIDTEKSWKDMLFSMKHAGDKVDQDLFPDRANPPIPST
FRVESLEGTYSNAGFGEFTLHRELGPERRPAEIVLVADRSNMTWRYQFRLHHVSGNFWVVHATIAGNPTLLHDYH
RGEFRAGINGNVSELKIEWTGVLGGDHEGTSVFAKVA*
Coding >OphauG2|7089
ATGTCTCTGGCTGTCATTGACGGACACAAGGTCTATGCCAAGGGATATGGATTCGCAACGCTGCCCAGCACGCCG
GCCACTCCAGAGACGCTGTGGTATGGGGCATCGACAACAAAGGCGTACATCGCCGCCGCCATGGGGCATCTGGTG
GACTCGGGAGAGCACGCGCAGCTGGCCAAGGGCTGGGACACGGCCATTGCGTCCATTCTTCGCGACGACTTTGTC
CTCGAGGATGAATGGGCCACCAACCACGTAACGCTGGACGATGCCGTCAGCCACCGCAGTGGCATGACGCGGCAT
GACAAGTCGTGCATGCACATGGTCAATGGGAGCCAGGCATCGCCCAGAGATGTCGTGCGCAACCTGAGGAATCTG
CCGCTGAGGCGTGAGCCACGCGTCAAGTTTTCTTATTGCAACCTCATGTATGTGACTCTGGGCCATGCTCTTGAA
AGGCTCACTGGCAAGCCCGTGGCCAAGCTGCTGCATGACGTGATATGGAGGCCCCTTGGCATGAAGGCCACCTTT
CTCCATCTCCACGACGCTCTACAGGCGCCACAGCATCTTGCCTCGGGCTACTGGTGGGATGACCAGACCGACACC
TTCAAGCCGGTTGAGCATATGCATCTCTCCGAGCTCGTCTCGGCTGGCGGAATCATCTCCAACGTGCTCGACTAT
GCCCAGTGGATCAAGTGTCTGATCCATCAGCAAGCGCCCTTTTCCAACAGGGTACACGCCGATATCAGAAGGCCA
AGAATCATCAAGGACGACGTGTCGCTGCCCGGACTGGAATTCTCTCTCTATGGACTTGGGTGGGAGCATAGGAGC
TACATGGGACACACCGTCCTGACACATAATGGCATACTCGATGCCTTTGGAGCCCAGGTCTACTGGCTGCCAGAC
GCCAAGTTTGGTGCCGTCGCCTTTGCCAACACTGCGTGGACTTCCAACGCCGTGCAAGACATTGTCATCCATGGC
TTAATACGCGACAAACTTGGTATCCGGCAGGGCGACATGATTGATACGGAGAAGAGTTGGAAAGACATGCTGTTC
AGTATGAAGCATGCGGGGGACAAGGTTGACCAAGACTTGTTCCCGGACCGAGCAAATCCCCCCATCCCATCCACG
TTTAGGGTTGAGAGCCTCGAGGGCACCTACTCGAATGCAGGCTTTGGAGAATTCACGCTGCATCGAGAACTGGGC
CCTGAGAGGAGACCAGCCGAGATTGTTCTTGTGGCAGACCGGAGCAACATGACGTGGCGGTACCAGTTTAGGCTG
CACCACGTGTCGGGAAACTTCTGGGTCGTCCACGCCACCATTGCAGGGAACCCAACCTTGCTTCATGACTATCAC
AGGGGCGAATTCAGGGCCGGGATCAACGGCAACGTGTCTGAGCTGAAAATCGAGTGGACTGGAGTCCTGGGCGGT
GACCATGAGGGAACATCAGTCTTTGCAAAGGTGGCGTAG
Transcript >OphauG2|7089
ATGTCTCTGGCTGTCATTGACGGACACAAGGTCTATGCCAAGGGATATGGATTCGCAACGCTGCCCAGCACGCCG
GCCACTCCAGAGACGCTGTGGTATGGGGCATCGACAACAAAGGCGTACATCGCCGCCGCCATGGGGCATCTGGTG
GACTCGGGAGAGCACGCGCAGCTGGCCAAGGGCTGGGACACGGCCATTGCGTCCATTCTTCGCGACGACTTTGTC
CTCGAGGATGAATGGGCCACCAACCACGTAACGCTGGACGATGCCGTCAGCCACCGCAGTGGCATGACGCGGCAT
GACAAGTCGTGCATGCACATGGTCAATGGGAGCCAGGCATCGCCCAGAGATGTCGTGCGCAACCTGAGGAATCTG
CCGCTGAGGCGTGAGCCACGCGTCAAGTTTTCTTATTGCAACCTCATGTATGTGACTCTGGGCCATGCTCTTGAA
AGGCTCACTGGCAAGCCCGTGGCCAAGCTGCTGCATGACGTGATATGGAGGCCCCTTGGCATGAAGGCCACCTTT
CTCCATCTCCACGACGCTCTACAGGCGCCACAGCATCTTGCCTCGGGCTACTGGTGGGATGACCAGACCGACACC
TTCAAGCCGGTTGAGCATATGCATCTCTCCGAGCTCGTCTCGGCTGGCGGAATCATCTCCAACGTGCTCGACTAT
GCCCAGTGGATCAAGTGTCTGATCCATCAGCAAGCGCCCTTTTCCAACAGGGTACACGCCGATATCAGAAGGCCA
AGAATCATCAAGGACGACGTGTCGCTGCCCGGACTGGAATTCTCTCTCTATGGACTTGGGTGGGAGCATAGGAGC
TACATGGGACACACCGTCCTGACACATAATGGCATACTCGATGCCTTTGGAGCCCAGGTCTACTGGCTGCCAGAC
GCCAAGTTTGGTGCCGTCGCCTTTGCCAACACTGCGTGGACTTCCAACGCCGTGCAAGACATTGTCATCCATGGC
TTAATACGCGACAAACTTGGTATCCGGCAGGGCGACATGATTGATACGGAGAAGAGTTGGAAAGACATGCTGTTC
AGTATGAAGCATGCGGGGGACAAGGTTGACCAAGACTTGTTCCCGGACCGAGCAAATCCCCCCATCCCATCCACG
TTTAGGGTTGAGAGCCTCGAGGGCACCTACTCGAATGCAGGCTTTGGAGAATTCACGCTGCATCGAGAACTGGGC
CCTGAGAGGAGACCAGCCGAGATTGTTCTTGTGGCAGACCGGAGCAACATGACGTGGCGGTACCAGTTTAGGCTG
CACCACGTGTCGGGAAACTTCTGGGTCGTCCACGCCACCATTGCAGGGAACCCAACCTTGCTTCATGACTATCAC
AGGGGCGAATTCAGGGCCGGGATCAACGGCAACGTGTCTGAGCTGAAAATCGAGTGGACTGGAGTCCTGGGCGGT
GACCATGAGGGAACATCAGTCTTTGCAAAGGTGGCGTAG
Gene >OphauG2|7089
ATGTCTCTGGCTGTCATTGACGGACACAAGGTCTATGCCAAGGTTTCAAAATATGCCCTCTTGCACCCTGACGGG
GCTGCCACTCTGACAGTGCGCAGGGATATGGATTCGCAACGCTGCCCAGCACGCCGGCCACTCCAGAGACGCTGT
GGTATGGGGCATCGACAACAAAGGCGTACATCGCCGCCGCCATGGGGCATCTGGTGGACTCGGGAGAGCACGCGC
AGCTGGCCAAGGGCTGGGACACGGCCATTGCGTCCATTCTTCGCGACGACTTTGTCCTCGAGGATGAATGGGCCA
CCAACCACGTAACGCTGGACGATGCCGTCAGCCACCGCAGTGGCATGACGCGGCATGACAAGTCGTGCATGCACA
TGGTCAATGGGAGCCAGGCATCGCCCAGAGATGTCGTGCGCAACCTGAGGAATCTGCCGCTGAGGCGTGAGCCAC
GCGTCAAGTTTTCTTATTGCAACCTCATGTATGTGACTCTGGGCCATGCTCTTGAAAGGCTCACTGGCAAGCCCG
TGGCCAAGCTGCTGCATGACGTGATATGGAGGCCCCTTGGCATGAAGGCCACCTTTCTCCATCTCCACGACGCTC
TACAGGCGCCACAGCATCTTGCCTCGGGCTACTGGTGGGATGACCAGACCGACACCTTCAAGCCGGTTGAGCATA
TGCATCTCTCCGAGCTCGTCTCGGCTGGCGGAATCATCTCCAACGTGCTCGACTATGCCCAGTGGATCAAGTGTC
TGATCCATCAGCAAGCGCCCTTTTCCAACAGGGTACACGCCGATATCAGAAGGCCAAGAATCATCAAGGACGACG
TGTCGCTGCCCGGACTGGAATTCTCTCTCTATGGACTTGGGTGGGAGCATAGGAGCTACATGGGACACACCGTCC
TGACACATAATGGCATACTCGATGCCTTTGGAGCCCAGGTCTACTGGCTGCCAGACGCCAAGTTTGGTGCCGTCG
CCTTTGCCAACACTGCGTGGACTTCCAACGCCGTGCAAGACATTGTCATCCATGGCTTAATACGCGACAAACTTG
GTATCCGGCAGGGCGACATGATTGATACGGAGAAGAGGTACGTTGCCGGCAAAGCAAGACACAGCTCCTTGAAAC
TTACCTGCTGGGGCACTTGACTTAGTTGGAAAGACATGCTGTTCAGTATGAAGCATGCGGGGGACAAGGTTGACC
AAGACTTGTTCCCGGACCGAGCAAATCCCCCCATCCCATCCACGTTTAGGGTTGAGAGCCTCGAGGGCACCTACT
CGAATGCAGGCTTTGGAGAATTCACGCTGCATCGAGAACTGGGCCCTGAGAGGAGACCAGCCGAGATTGTTCTTG
TGGCAGACCGGAGCAACATGACGTGGCGGTACCAGTTTAGGCTGCACCACGTGTCGGGAAACTTCTGGGTCGTCC
ACGCCACCATTGCAGGGAACCCAACCTTGCTTCATGACTATCACAGGGGCGAATTCAGGGCCGGGATCAACGGCA
ACGTGTCTGAGCTGAAAATCGAGTGGACTGGAGTCCTGGGCGGTGACCATGAGGGAACATCAGTCTTTGCAAAGG
TGGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail