Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7082
Gene name
LocationContig_79:34051..37237
Strand+
Gene length (bp)3186
Transcript length (bp)3186
Coding sequence length (bp)3186
Protein length (aa) 1062

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17911 Ski2_N Ski2 N-terminal region 8.6E-35 56 200
PF13234 rRNA_proc-arch rRNA-processing arch domain 5.6E-23 814 1059
PF00270 DEAD DEAD/DEAH box helicase 1.8E-17 306 452
PF00271 Helicase_C Helicase conserved C-terminal domain 2.8E-06 650 756

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59801|SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.03c PE=3 SV=1 42 1059 0.0E+00
sp|P35207|SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI2 PE=1 SV=2 29 997 0.0E+00
sp|F4JAA5|SKI2_ARATH DExH-box ATP-dependent RNA helicase DExH11 OS=Arabidopsis thaliana GN=SKI2 PE=1 SV=1 28 899 0.0E+00
sp|Q15477|SKIV2_HUMAN Helicase SKI2W OS=Homo sapiens GN=SKIV2L PE=1 SV=3 35 993 0.0E+00
sp|P47047|MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTR4 PE=1 SV=1 294 870 3.0E-136
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59801|SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.03c PE=3 SV=1 42 1059 0.0E+00
sp|P35207|SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI2 PE=1 SV=2 29 997 0.0E+00
sp|F4JAA5|SKI2_ARATH DExH-box ATP-dependent RNA helicase DExH11 OS=Arabidopsis thaliana GN=SKI2 PE=1 SV=1 28 899 0.0E+00
sp|Q15477|SKIV2_HUMAN Helicase SKI2W OS=Homo sapiens GN=SKIV2L PE=1 SV=3 35 993 0.0E+00
sp|P47047|MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTR4 PE=1 SV=1 294 870 3.0E-136
sp|Q9CZU3|SK2L2_MOUSE Superkiller viralicidic activity 2-like 2 OS=Mus musculus GN=Skiv2l2 PE=1 SV=1 292 847 6.0E-136
sp|Q23223|MTR4_CAEEL mRNA transport homolog 4 OS=Caenorhabditis elegans GN=mtr-4 PE=3 SV=1 286 835 8.0E-136
sp|P42285|SK2L2_HUMAN Superkiller viralicidic activity 2-like 2 OS=Homo sapiens GN=SKIV2L2 PE=1 SV=3 292 847 2.0E-135
sp|Q9XIF2|MTR4_ARATH DExH-box ATP-dependent RNA helicase DExH9 OS=Arabidopsis thaliana GN=MTR4 PE=2 SV=1 287 838 9.0E-131
sp|B9DFG3|ISE2_ARATH DExH-box ATP-dependent RNA helicase DExH15 chloroplastic OS=Arabidopsis thaliana GN=ISE2 PE=1 SV=2 263 873 3.0E-78
sp|O14232|MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtr4 PE=1 SV=1 215 514 3.0E-69
sp|O13799|YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.02 PE=1 SV=1 296 517 8.0E-66
sp|Q9ZVW2|HEN2_ARATH DExH-box ATP-dependent RNA helicase DExH10 OS=Arabidopsis thaliana GN=HEN2 PE=1 SV=2 294 513 1.0E-64
sp|O14232|MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtr4 PE=1 SV=1 605 841 3.0E-54
sp|Q9ZVW2|HEN2_ARATH DExH-box ATP-dependent RNA helicase DExH10 OS=Arabidopsis thaliana GN=HEN2 PE=1 SV=2 605 832 2.0E-52
sp|O13799|YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.02 PE=1 SV=1 616 878 2.0E-50
sp|P9WMR1|HELY_MYCTU Probable helicase HelY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=helY PE=1 SV=1 298 494 2.0E-44
sp|P9WMR0|HELY_MYCTO Probable helicase HelY OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=helY PE=3 SV=1 298 494 2.0E-44
sp|Q9ZBD8|HELY_MYCLE Probable helicase HelY OS=Mycobacterium leprae (strain TN) GN=helY PE=3 SV=1 285 502 5.0E-44
sp|P9WMR1|HELY_MYCTU Probable helicase HelY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=helY PE=1 SV=1 605 824 3.0E-31
sp|P9WMR0|HELY_MYCTO Probable helicase HelY OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=helY PE=3 SV=1 605 824 3.0E-31
sp|Q9ZBD8|HELY_MYCLE Probable helicase HelY OS=Mycobacterium leprae (strain TN) GN=helY PE=3 SV=1 585 824 1.0E-30
sp|Q9YFQ8|HELS_AERPE ATP-dependent DNA helicase Hel308 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hel308 PE=3 SV=2 314 484 8.0E-18
sp|Q5H9U9|DDX6L_HUMAN Probable ATP-dependent RNA helicase DDX60-like OS=Homo sapiens GN=DDX60L PE=2 SV=2 629 806 2.0E-17
sp|A7IB61|HELS_METB6 ATP-dependent DNA helicase Hel308 OS=Methanoregula boonei (strain 6A8) GN=hel308 PE=3 SV=1 314 487 3.0E-17
sp|Q9V0A9|HELS_PYRAB ATP-dependent DNA helicase Hel308 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=hel308 PE=3 SV=1 317 479 3.0E-17
sp|F0NDL2|HELS_SULIR ATP-dependent DNA helicase Hel308 OS=Sulfolobus islandicus (strain REY15A) GN=hel308 PE=3 SV=1 274 479 4.0E-17
sp|Q97VY9|HELS_SULSO ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hel308 PE=3 SV=1 307 479 4.0E-17
sp|O59025|HELS_PYRHO ATP-dependent DNA helicase Hel308 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=hel308 PE=3 SV=1 316 479 9.0E-17
sp|D0KN27|HELS_SULS9 ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain 98/2) GN=hel308 PE=1 SV=1 307 479 1.0E-16
sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 246 483 6.0E-16
sp|Q974S1|HELS_SULTO ATP-dependent DNA helicase Hel308 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hel308 PE=1 SV=1 307 481 6.0E-16
sp|Q9HJX7|HELS_THEAC ATP-dependent DNA helicase Hel308 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hel308 PE=3 SV=1 301 480 7.0E-16
sp|Q4JC00|HELS_SULAC ATP-dependent DNA helicase Hel308 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hel308 PE=3 SV=1 320 481 8.0E-16
sp|Q5JGV6|HELS_THEKO ATP-dependent DNA helicase Hel308 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=hel308 PE=3 SV=1 317 479 2.0E-15
sp|Q5UYM9|HELS_HALMA ATP-dependent DNA helicase Hel308 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hel308 PE=3 SV=1 285 490 2.0E-15
sp|Q9YFQ8|HELS_AERPE ATP-dependent DNA helicase Hel308 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hel308 PE=3 SV=2 617 766 3.0E-15
sp|Q97AI2|HELS_THEVO ATP-dependent DNA helicase Hel308 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hel308 PE=3 SV=1 301 480 3.0E-15
sp|P0DMI1|HELS_ARCFU ATP-dependent DNA helicase Hel308 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hel308 PE=1 SV=1 307 479 3.0E-15
sp|Q9P7T8|YIW2_SCHPO Uncharacterized helicase C694.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC694.02 PE=3 SV=1 301 484 5.0E-15
sp|O73946|HELS_PYRFU ATP-dependent DNA helicase Hel308 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hel308 PE=1 SV=1 317 514 9.0E-15
sp|Q97VY9|HELS_SULSO ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hel308 PE=3 SV=1 617 842 1.0E-14
sp|D0KN27|HELS_SULS9 ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain 98/2) GN=hel308 PE=1 SV=1 617 842 1.0E-14
sp|Q09475|YP93_CAEEL Uncharacterized helicase C28H8.3 OS=Caenorhabditis elegans GN=C28H8.3 PE=3 SV=2 651 833 1.0E-14
sp|Q8TL39|HELS_METAC ATP-dependent DNA helicase Hel308 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hel308 PE=3 SV=1 307 479 2.0E-14
sp|F0NDL2|HELS_SULIR ATP-dependent DNA helicase Hel308 OS=Sulfolobus islandicus (strain REY15A) GN=hel308 PE=3 SV=1 617 842 3.0E-14
sp|A6UN73|HELS_METVS ATP-dependent DNA helicase Hel308 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hel308 PE=3 SV=1 314 535 3.0E-14
sp|O26901|HELS_METTH ATP-dependent DNA helicase Hel308 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hel308 PE=1 SV=1 302 479 4.0E-14
sp|A3MSA1|HELS_PYRCJ ATP-dependent DNA helicase Hel308 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=hel308 PE=3 SV=1 672 766 5.0E-14
sp|Q3IU46|HELS_NATPD ATP-dependent DNA helicase Hel308 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hel308 PE=3 SV=1 318 490 9.0E-14
sp|P0DMI1|HELS_ARCFU ATP-dependent DNA helicase Hel308 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hel308 PE=1 SV=1 671 795 1.0E-13
sp|D3Z4R1|HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus GN=Hfm1 PE=3 SV=2 294 480 1.0E-13
sp|Q8IY21|DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens GN=DDX60 PE=1 SV=3 637 806 2.0E-13
sp|A8MB76|HELS_CALMQ ATP-dependent DNA helicase Hel308 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=hel308 PE=3 SV=1 664 818 2.0E-13
sp|A8MB76|HELS_CALMQ ATP-dependent DNA helicase Hel308 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=hel308 PE=3 SV=1 287 499 3.0E-13
sp|Q465R3|HELS_METBF ATP-dependent DNA helicase Hel308 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hel308 PE=3 SV=1 301 459 3.0E-13
sp|A3MSA1|HELS_PYRCJ ATP-dependent DNA helicase Hel308 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=hel308 PE=3 SV=1 316 484 4.0E-13
sp|Q54XN7|Y8827_DICDI Uncharacterized helicase DDB_G0278827 OS=Dictyostelium discoideum GN=DDB_G0278827 PE=3 SV=1 603 766 4.0E-13
sp|Q0W6L1|HELS_METAR ATP-dependent DNA helicase Hel308 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hel308 PE=3 SV=1 302 481 4.0E-13
sp|Q09475|YP93_CAEEL Uncharacterized helicase C28H8.3 OS=Caenorhabditis elegans GN=C28H8.3 PE=3 SV=2 301 482 5.0E-13
sp|Q588V7|TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana GN=TEB PE=2 SV=1 619 769 5.0E-13
sp|Q12WZ6|HELS_METBU ATP-dependent DNA helicase Hel308 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hel308 PE=3 SV=1 670 766 7.0E-13
sp|Q9SYP1|DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana GN=EMB1507 PE=2 SV=1 617 766 7.0E-13
sp|Q8TL39|HELS_METAC ATP-dependent DNA helicase Hel308 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hel308 PE=3 SV=1 679 766 8.0E-13
sp|Q9P7T8|YIW2_SCHPO Uncharacterized helicase C694.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC694.02 PE=3 SV=1 674 805 9.0E-13
sp|Q8PZR7|HELS_METMA ATP-dependent DNA helicase Hel308 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hel308 PE=3 SV=1 622 766 9.0E-13
sp|Q8PZR7|HELS_METMA ATP-dependent DNA helicase Hel308 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hel308 PE=3 SV=1 301 479 1.0E-12
sp|A2RUV5|HFM1_XENTR Probable ATP-dependent DNA helicase HFM1 OS=Xenopus tropicalis GN=hfm1 PE=2 SV=1 297 479 1.0E-12
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 619 770 1.0E-12
sp|Q6P4T2|U520_MOUSE U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus GN=Snrnp200 PE=1 SV=1 619 770 1.0E-12
sp|Q0W6L1|HELS_METAR ATP-dependent DNA helicase Hel308 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hel308 PE=3 SV=1 671 766 2.0E-12
sp|Q12WZ6|HELS_METBU ATP-dependent DNA helicase Hel308 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hel308 PE=3 SV=1 319 460 2.0E-12
sp|F1LNJ2|U520_RAT U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus GN=Snrnp200 PE=1 SV=1 619 770 2.0E-12
sp|Q54G57|HELC1_DICDI Activating signal cointegrator 1 complex subunit 3 OS=Dictyostelium discoideum GN=ascc3 PE=3 SV=1 617 766 2.0E-12
sp|Q58796|Y1401_METJA Probable ATP-dependent helicase MJ1401 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1401 PE=3 SV=1 314 506 2.0E-12
sp|Q8CGS6|DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus GN=Polq PE=1 SV=2 619 808 3.0E-12
sp|Q974S1|HELS_SULTO ATP-dependent DNA helicase Hel308 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hel308 PE=1 SV=1 659 833 4.0E-12
sp|P32639|BRR2_YEAST Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRR2 PE=1 SV=2 619 766 4.0E-12
sp|Q55CI8|HELCL_DICDI Activating signal cointegrator 1 complex subunit 3-like OS=Dictyostelium discoideum GN=ascc3l PE=3 SV=1 619 766 5.0E-12
sp|Q9HMV6|HELS_HALSA ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hel308 PE=3 SV=1 302 490 5.0E-12
sp|B0R7Q2|HELS_HALS3 ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hel308 PE=3 SV=1 302 490 5.0E-12
sp|Q465R3|HELS_METBF ATP-dependent DNA helicase Hel308 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hel308 PE=3 SV=1 679 766 7.0E-12
sp|Q2VPA6|HELQ_MOUSE Helicase POLQ-like OS=Mus musculus GN=Helq PE=1 SV=2 619 766 7.0E-12
sp|Q9U2G0|U520_CAEEL Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Caenorhabditis elegans GN=Y46G5A.4 PE=3 SV=1 619 766 7.0E-12
sp|A2PYH4|HFM1_HUMAN Probable ATP-dependent DNA helicase HFM1 OS=Homo sapiens GN=HFM1 PE=1 SV=2 294 480 8.0E-12
sp|Q9VUV9|U520_DROME Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster GN=l(3)72Ab PE=2 SV=4 619 766 8.0E-12
sp|Q58524|HELS_METJA ATP-dependent DNA helicase Hel308 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hel308 PE=3 SV=1 314 484 9.0E-12
sp|Q9HMV6|HELS_HALSA ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hel308 PE=3 SV=1 618 795 1.0E-11
sp|B0R7Q2|HELS_HALS3 ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hel308 PE=3 SV=1 618 795 1.0E-11
sp|O75417|DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 SV=2 619 766 1.0E-11
sp|Q4JC00|HELS_SULAC ATP-dependent DNA helicase Hel308 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hel308 PE=3 SV=1 617 766 2.0E-11
sp|D3Z4R1|HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus GN=Hfm1 PE=3 SV=2 616 766 3.0E-11
sp|Q9UT24|BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brr2 PE=1 SV=1 672 766 8.0E-11
sp|Q5D892|MER3_ARATH DExH-box ATP-dependent RNA helicase DExH17 OS=Arabidopsis thaliana GN=MER3 PE=2 SV=1 283 479 8.0E-11
sp|A7IB61|HELS_METB6 ATP-dependent DNA helicase Hel308 OS=Methanoregula boonei (strain 6A8) GN=hel308 PE=3 SV=1 619 766 1.0E-10
sp|A2PYH4|HFM1_HUMAN Probable ATP-dependent DNA helicase HFM1 OS=Homo sapiens GN=HFM1 PE=1 SV=2 671 773 1.0E-10
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 310 483 1.0E-10
sp|Q9FNQ1|DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana GN=At5g61140 PE=2 SV=1 616 766 1.0E-10
sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 299 483 2.0E-10
sp|Q9UT24|BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brr2 PE=1 SV=1 318 481 2.0E-10
sp|Q8TDG4|HELQ_HUMAN Helicase POLQ-like OS=Homo sapiens GN=HELQ PE=1 SV=2 604 766 3.0E-10
sp|O59025|HELS_PYRHO ATP-dependent DNA helicase Hel308 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=hel308 PE=3 SV=1 600 795 4.0E-10
sp|P51979|HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFM1 PE=1 SV=3 302 509 4.0E-10
sp|Q5UYM9|HELS_HALMA ATP-dependent DNA helicase Hel308 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hel308 PE=3 SV=1 618 795 5.0E-10
sp|O48534|DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana GN=At2g42270 PE=2 SV=1 619 766 5.0E-10
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 315 496 8.0E-10
sp|F1NTD6|ASCC3_CHICK Activating signal cointegrator 1 complex subunit 3 OS=Gallus gallus GN=ascc3 PE=3 SV=2 671 766 9.0E-10
sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 616 765 1.0E-09
sp|Q54XN7|Y8827_DICDI Uncharacterized helicase DDB_G0278827 OS=Dictyostelium discoideum GN=DDB_G0278827 PE=3 SV=1 301 489 1.0E-09
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 314 481 1.0E-09
sp|Q54G57|HELC1_DICDI Activating signal cointegrator 1 complex subunit 3 OS=Dictyostelium discoideum GN=ascc3 PE=3 SV=1 652 766 1.0E-09
sp|Q9FNQ1|DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana GN=At5g61140 PE=2 SV=1 617 766 1.0E-09
sp|F1NTD6|ASCC3_CHICK Activating signal cointegrator 1 complex subunit 3 OS=Gallus gallus GN=ascc3 PE=3 SV=2 284 483 1.0E-09
sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=1 SV=1 671 766 1.0E-09
sp|Q97AI2|HELS_THEVO ATP-dependent DNA helicase Hel308 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hel308 PE=3 SV=1 617 821 2.0E-09
sp|O26901|HELS_METTH ATP-dependent DNA helicase Hel308 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hel308 PE=1 SV=1 670 766 2.0E-09
sp|Q6P4T2|U520_MOUSE U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus GN=Snrnp200 PE=1 SV=1 314 481 2.0E-09
sp|F1LNJ2|U520_RAT U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus GN=Snrnp200 PE=1 SV=1 314 481 2.0E-09
sp|Q9FNQ1|DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana GN=At5g61140 PE=2 SV=1 309 498 2.0E-09
sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=1 SV=1 290 483 2.0E-09
sp|F1LPQ2|ASCC3_RAT Activating signal cointegrator 1 complex subunit 3 OS=Rattus norvegicus GN=Ascc3 PE=3 SV=1 671 766 2.0E-09
sp|F1LPQ2|ASCC3_RAT Activating signal cointegrator 1 complex subunit 3 OS=Rattus norvegicus GN=Ascc3 PE=3 SV=1 290 483 2.0E-09
sp|Q8N3C0|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3 290 483 2.0E-09
sp|O18475|DPOLQ_DROME DNA polymerase theta OS=Drosophila melanogaster GN=mus308 PE=1 SV=1 606 766 2.0E-09
sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 671 766 2.0E-09
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 300 490 3.0E-09
sp|Q6P4T2|U520_MOUSE U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus GN=Snrnp200 PE=1 SV=1 300 490 3.0E-09
sp|F1LNJ2|U520_RAT U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus GN=Snrnp200 PE=1 SV=1 300 490 3.0E-09
sp|Q9UT24|BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brr2 PE=1 SV=1 286 483 3.0E-09
sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 290 483 3.0E-09
sp|Q54G57|HELC1_DICDI Activating signal cointegrator 1 complex subunit 3 OS=Dictyostelium discoideum GN=ascc3 PE=3 SV=1 309 479 4.0E-09
sp|Q8N3C0|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3 671 766 4.0E-09
sp|Q9V0A9|HELS_PYRAB ATP-dependent DNA helicase Hel308 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=hel308 PE=3 SV=1 600 824 5.0E-09
sp|F1LPQ2|ASCC3_RAT Activating signal cointegrator 1 complex subunit 3 OS=Rattus norvegicus GN=Ascc3 PE=3 SV=1 672 766 5.0E-09
sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=1 SV=1 672 766 6.0E-09
sp|Q8N3C0|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3 672 766 6.0E-09
sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 672 766 8.0E-09
sp|F1NTD6|ASCC3_CHICK Activating signal cointegrator 1 complex subunit 3 OS=Gallus gallus GN=ascc3 PE=3 SV=2 659 766 1.0E-08
sp|Q9HJX7|HELS_THEAC ATP-dependent DNA helicase Hel308 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hel308 PE=3 SV=1 672 761 2.0E-08
sp|O73946|HELS_PYRFU ATP-dependent DNA helicase Hel308 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hel308 PE=1 SV=1 602 818 2.0E-08
sp|Q8IY21|DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens GN=DDX60 PE=1 SV=3 304 463 2.0E-08
sp|A2RUV5|HFM1_XENTR Probable ATP-dependent DNA helicase HFM1 OS=Xenopus tropicalis GN=hfm1 PE=2 SV=1 671 773 2.0E-08
sp|Q9U2G0|U520_CAEEL Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Caenorhabditis elegans GN=Y46G5A.4 PE=3 SV=1 314 481 2.0E-08
sp|Q9VUV9|U520_DROME Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster GN=l(3)72Ab PE=2 SV=4 314 481 2.0E-08
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 616 761 2.0E-08
sp|O48534|DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana GN=At2g42270 PE=2 SV=1 286 483 2.0E-08
sp|E7F8F4|ASCC3_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio GN=ascc3 PE=3 SV=2 672 766 2.0E-08
sp|P32639|BRR2_YEAST Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRR2 PE=1 SV=2 301 480 4.0E-08
sp|P32639|BRR2_YEAST Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRR2 PE=1 SV=2 303 479 4.0E-08
sp|O48534|DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana GN=At2g42270 PE=2 SV=1 314 479 4.0E-08
sp|B6DMK2|MER3_ORYSJ ATP-dependent DNA helicase MER3 homolog OS=Oryza sativa subsp. japonica GN=MER3 PE=2 SV=1 319 479 6.0E-08
sp|Q9SYP1|DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana GN=EMB1507 PE=2 SV=1 286 483 8.0E-08
sp|Q914M3|Y007_SIFVH Putative helicase 7 OS=Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) GN=SIFV0007 PE=3 SV=1 302 490 1.0E-07
sp|P51979|HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFM1 PE=1 SV=3 612 766 2.0E-07
sp|E7F8F4|ASCC3_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio GN=ascc3 PE=3 SV=2 671 761 2.0E-07
sp|O75417|DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 SV=2 317 500 4.0E-07
sp|Q5D892|MER3_ARATH DExH-box ATP-dependent RNA helicase DExH17 OS=Arabidopsis thaliana GN=MER3 PE=2 SV=1 671 766 4.0E-07
sp|B6DMK2|MER3_ORYSJ ATP-dependent DNA helicase MER3 homolog OS=Oryza sativa subsp. japonica GN=MER3 PE=2 SV=1 671 766 6.0E-07
sp|Q55CI8|HELCL_DICDI Activating signal cointegrator 1 complex subunit 3-like OS=Dictyostelium discoideum GN=ascc3l PE=3 SV=1 314 481 7.0E-07
sp|Q8CGS6|DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus GN=Polq PE=1 SV=2 313 500 8.0E-07
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 619 754 9.0E-07
sp|F1LPQ2|ASCC3_RAT Activating signal cointegrator 1 complex subunit 3 OS=Rattus norvegicus GN=Ascc3 PE=3 SV=1 316 505 9.0E-07
sp|Q3IU46|HELS_NATPD ATP-dependent DNA helicase Hel308 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hel308 PE=3 SV=1 619 766 2.0E-06
sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=1 SV=1 316 505 2.0E-06
sp|A0FLQ6|DPOLQ_CAEEL DNA polymerase theta OS=Caenorhabditis elegans GN=polq-1 PE=1 SV=2 320 491 2.0E-06
sp|A0FLQ6|DPOLQ_CAEEL DNA polymerase theta OS=Caenorhabditis elegans GN=polq-1 PE=1 SV=2 676 766 4.0E-06
sp|A6UN73|HELS_METVS ATP-dependent DNA helicase Hel308 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hel308 PE=3 SV=1 672 824 6.0E-06
sp|Q54G57|HELC1_DICDI Activating signal cointegrator 1 complex subunit 3 OS=Dictyostelium discoideum GN=ascc3 PE=3 SV=1 300 483 6.0E-06
sp|Q8N3C0|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3 316 505 6.0E-06
sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 316 505 6.0E-06
sp|Q9SYP1|DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana GN=EMB1507 PE=2 SV=1 314 479 9.0E-06
sp|F1NTD6|ASCC3_CHICK Activating signal cointegrator 1 complex subunit 3 OS=Gallus gallus GN=ascc3 PE=3 SV=2 316 479 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0005488 binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0032553 ribonucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1918
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7082 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|466
Ophiocordyceps camponoti-floridani Ophcf2|02968
Ophiocordyceps camponoti-rufipedis Ophun1|6311
Ophiocordyceps kimflemingae Ophio5|6905
Ophiocordyceps subramaniannii Hirsu2|2020

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7082
MPSINDLLVSEEEEEDISSKTPLADCKREDPEAQKNELEKQFLSPCSDFSAEWLNRLQQRWDIEPDYRSLFKIAP
TQTRTVTRFLRQGLQGRVVGYQNITVPMNRSTAKNSTSLQRQPANRADFVRGAAGFFPFTPGGLDSIEATAALED
QLYSGDKPDGDSNANRLDRVIPLGSTGRLLEIAPGMSRGIDFSLSNKSQSKASADDILKILEQDAEQEPRQKLNE
ALAANESSEETTNGESDYDPIDEFLPVEFPSFEPHGVLATSSARKTGREWAHMVDIRHGMPNFGELVPNMARDWP
FELDTFQKEAVYHLENGDSVFVAAHTSAGKTVVAEYAIALAAKHMTKAIYTSPIKALSNQKFRDFRQDFSEVGIL
TGDVQINPEASCLIMTTEILRSMLYRGADLIRDVEFVIFDEVHYVNDFERGVVWEEVIIMLPEHVSLILLSATVP
NTYEFASWVGRTKQKDIYVISTSKRPVPLEHYLWVANDMHKIVDSDKKFLESGWKSAHNAVQKKDKQWTDNNNNT
MAIRGGNNRGGQRGGGQRGGQQQRGGGRGGGPRGGGGNQQRGRGGGGPPRASHTPGHMGRGGRAAGMASAAQDRN
LWVHLVQFLRKKTLLPACIFVFSKKRCEQNADALSNQDFCTASEKSRIHIVIEKSIARLKPEDRVLPQIVRLRDL
LGRGIAVHHGGLLPIVKELVEILFAQTLVKVLFATETFAMGLNLPTRTVVFSGYRKHDGQSFRNLLPGEYTQMAG
RAGRRGLDTVGSVILVPPGGTDDVPPVADLRNMILGEPSKLRSQFRLTYNMILNLLRVEALKIEEMIKRSFSEHA
TQALLPEHEKDVKLAQADLAKIKREACQICDSDMDECHQAAQDFKQLTFQLYKGLLHIPLGRRMFVSQRVVVFQW
DGIRTIGLLLADGMSPRGSTDDPIIQVCAVKPLRDRRDASDQLPFIPAFRKYLINLPSARKQIHMRSLNVPLRDI
ECLTRWVLKGTVPEILKDGQAGHQAVERVQEICHSWDDRLNELDLSRVKSLHLQEIKEKRTQLMSKMQSSPAVLC
KMFLKHVSLLL*
Coding >OphauG2|7082
ATGCCGAGCATCAACGATTTGCTTGTTTCCGAGGAGGAGGAGGAGGACATATCGTCAAAAACCCCCTTGGCCGAT
TGCAAACGCGAGGATCCAGAAGCACAGAAGAACGAGCTTGAGAAGCAGTTTTTATCACCATGCAGCGATTTTTCA
GCGGAATGGCTCAACCGCCTACAACAGCGATGGGACATTGAGCCCGATTATCGTTCGCTATTTAAAATAGCCCCG
ACTCAGACGCGCACCGTGACGAGGTTTCTGCGCCAGGGACTGCAAGGGCGAGTCGTGGGATATCAAAATATAACG
GTGCCGATGAATAGGTCTACAGCCAAGAACTCGACGTCTTTGCAACGGCAACCTGCTAACAGGGCGGACTTTGTA
CGCGGCGCTGCGGGCTTCTTTCCCTTTACTCCAGGAGGGCTGGATAGTATTGAAGCGACAGCCGCGTTGGAGGAC
CAACTTTACTCTGGCGACAAGCCCGATGGTGATTCAAACGCGAATCGTCTAGACCGAGTGATTCCTTTGGGGTCA
ACGGGGCGTCTACTCGAGATTGCCCCAGGCATGAGCCGCGGCATCGACTTTAGCCTTTCCAACAAGAGCCAAAGC
AAGGCATCGGCCGATGACATTCTGAAGATTCTCGAGCAAGATGCTGAGCAAGAGCCTCGTCAAAAGTTGAATGAG
GCTCTTGCTGCAAATGAGTCGTCGGAAGAGACGACGAATGGCGAAAGCGACTATGACCCAATTGATGAATTCCTA
CCCGTCGAGTTCCCCAGCTTCGAGCCTCACGGCGTTCTGGCTACGTCTAGTGCGAGAAAGACTGGGCGCGAATGG
GCACACATGGTGGACATTCGGCACGGCATGCCCAACTTTGGCGAACTGGTGCCAAACATGGCGCGCGACTGGCCG
TTTGAGCTTGACACGTTTCAAAAAGAAGCCGTCTACCACCTCGAAAACGGCGATTCCGTCTTTGTGGCGGCTCAC
ACATCGGCGGGCAAGACTGTGGTGGCCGAGTATGCTATTGCGTTGGCGGCAAAGCACATGACAAAAGCAATCTAC
ACATCGCCCATAAAGGCACTAAGCAATCAAAAGTTTCGTGATTTCCGCCAAGACTTTAGCGAGGTTGGCATCCTG
ACGGGCGACGTGCAAATAAATCCAGAGGCTAGTTGCCTTATTATGACGACTGAGATTTTACGCAGCATGCTTTAC
CGAGGAGCCGATTTAATACGCGATGTGGAGTTTGTCATTTTTGACGAAGTCCACTATGTCAACGACTTTGAGCGT
GGCGTTGTGTGGGAAGAAGTCATTATCATGCTGCCAGAACATGTGTCTCTCATCTTGCTTTCGGCTACCGTGCCC
AACACGTACGAGTTTGCGTCGTGGGTTGGCCGGACAAAACAAAAGGACATTTATGTCATTTCGACTTCCAAACGC
CCAGTACCTCTTGAGCACTATCTTTGGGTTGCTAATGACATGCACAAGATTGTTGATTCAGACAAGAAGTTTCTC
GAAAGCGGATGGAAGAGCGCTCACAATGCAGTCCAAAAGAAGGACAAGCAGTGGACTGACAACAACAACAACACC
ATGGCAATAAGAGGTGGCAACAATCGGGGTGGTCAGCGAGGTGGCGGCCAAAGAGGCGGCCAGCAACAACGGGGC
GGTGGCCGAGGAGGAGGACCTCGTGGTGGTGGTGGTAATCAGCAACGGGGACGCGGCGGTGGCGGCCCTCCTCGC
GCAAGCCATACTCCAGGCCACATGGGGCGTGGTGGACGAGCAGCAGGAATGGCCTCGGCTGCCCAAGACAGGAAT
CTCTGGGTACACCTGGTGCAGTTTCTCCGGAAAAAGACTCTGCTGCCAGCATGCATCTTTGTCTTTTCCAAGAAG
CGCTGCGAACAGAATGCAGACGCGCTCAGCAACCAGGACTTCTGCACAGCATCGGAAAAGAGCCGCATCCACATT
GTCATTGAAAAGTCGATTGCTCGCCTCAAGCCCGAAGACAGGGTGCTGCCGCAGATTGTCAGGCTGCGCGACCTT
TTGGGCCGAGGCATCGCAGTTCACCACGGCGGTCTTCTACCCATTGTCAAGGAGCTGGTTGAGATTTTGTTTGCA
CAGACCTTGGTCAAGGTGCTATTTGCCACTGAGACTTTTGCCATGGGCCTTAATCTTCCGACGCGAACAGTCGTC
TTTTCAGGCTACCGCAAGCACGACGGCCAGTCGTTTCGCAATCTGCTGCCGGGCGAGTACACGCAAATGGCTGGC
CGGGCTGGGCGACGCGGTCTAGACACGGTCGGCTCGGTTATTCTGGTGCCGCCTGGAGGCACCGATGATGTGCCA
CCCGTCGCTGATCTCCGCAACATGATTCTCGGCGAACCGTCCAAGCTGAGGTCACAGTTTCGCCTCACGTACAAC
ATGATTCTCAACCTGTTACGAGTGGAGGCACTGAAGATTGAGGAGATGATTAAGCGCAGCTTCTCTGAACACGCC
ACTCAGGCCTTGCTCCCCGAGCACGAAAAGGACGTCAAGCTGGCACAGGCAGATTTGGCAAAGATTAAGCGTGAG
GCGTGCCAGATTTGTGACAGTGACATGGACGAGTGCCATCAGGCCGCCCAAGACTTTAAGCAGCTTACGTTCCAG
CTGTACAAGGGCTTGCTGCACATTCCGCTTGGACGCAGAATGTTTGTGTCACAGCGAGTGGTTGTCTTTCAGTGG
GACGGGATCCGCACCATTGGTCTCTTGCTCGCCGACGGCATGAGCCCTCGAGGCTCCACGGACGACCCAATCATT
CAAGTCTGTGCCGTCAAGCCTCTCCGGGACCGGCGCGACGCCAGTGACCAGCTTCCCTTTATCCCAGCCTTTCGC
AAGTACCTCATCAACCTACCTAGCGCGCGGAAGCAAATCCACATGCGGTCGCTGAATGTGCCGCTGCGAGATATC
GAGTGCCTGACGCGGTGGGTGCTAAAGGGAACCGTGCCAGAGATACTCAAGGACGGCCAGGCCGGCCACCAGGCA
GTCGAACGAGTCCAAGAGATTTGTCACTCGTGGGATGACCGGCTGAATGAGTTGGACTTGAGCAGGGTTAAAAGT
CTACACTTGCAAGAAATCAAGGAGAAGCGCACGCAGCTGATGAGCAAGATGCAATCATCACCCGCTGTTTTGTGT
AAAATGTTTCTCAAACACGTAAGTCTATTACTATAG
Transcript >OphauG2|7082
ATGCCGAGCATCAACGATTTGCTTGTTTCCGAGGAGGAGGAGGAGGACATATCGTCAAAAACCCCCTTGGCCGAT
TGCAAACGCGAGGATCCAGAAGCACAGAAGAACGAGCTTGAGAAGCAGTTTTTATCACCATGCAGCGATTTTTCA
GCGGAATGGCTCAACCGCCTACAACAGCGATGGGACATTGAGCCCGATTATCGTTCGCTATTTAAAATAGCCCCG
ACTCAGACGCGCACCGTGACGAGGTTTCTGCGCCAGGGACTGCAAGGGCGAGTCGTGGGATATCAAAATATAACG
GTGCCGATGAATAGGTCTACAGCCAAGAACTCGACGTCTTTGCAACGGCAACCTGCTAACAGGGCGGACTTTGTA
CGCGGCGCTGCGGGCTTCTTTCCCTTTACTCCAGGAGGGCTGGATAGTATTGAAGCGACAGCCGCGTTGGAGGAC
CAACTTTACTCTGGCGACAAGCCCGATGGTGATTCAAACGCGAATCGTCTAGACCGAGTGATTCCTTTGGGGTCA
ACGGGGCGTCTACTCGAGATTGCCCCAGGCATGAGCCGCGGCATCGACTTTAGCCTTTCCAACAAGAGCCAAAGC
AAGGCATCGGCCGATGACATTCTGAAGATTCTCGAGCAAGATGCTGAGCAAGAGCCTCGTCAAAAGTTGAATGAG
GCTCTTGCTGCAAATGAGTCGTCGGAAGAGACGACGAATGGCGAAAGCGACTATGACCCAATTGATGAATTCCTA
CCCGTCGAGTTCCCCAGCTTCGAGCCTCACGGCGTTCTGGCTACGTCTAGTGCGAGAAAGACTGGGCGCGAATGG
GCACACATGGTGGACATTCGGCACGGCATGCCCAACTTTGGCGAACTGGTGCCAAACATGGCGCGCGACTGGCCG
TTTGAGCTTGACACGTTTCAAAAAGAAGCCGTCTACCACCTCGAAAACGGCGATTCCGTCTTTGTGGCGGCTCAC
ACATCGGCGGGCAAGACTGTGGTGGCCGAGTATGCTATTGCGTTGGCGGCAAAGCACATGACAAAAGCAATCTAC
ACATCGCCCATAAAGGCACTAAGCAATCAAAAGTTTCGTGATTTCCGCCAAGACTTTAGCGAGGTTGGCATCCTG
ACGGGCGACGTGCAAATAAATCCAGAGGCTAGTTGCCTTATTATGACGACTGAGATTTTACGCAGCATGCTTTAC
CGAGGAGCCGATTTAATACGCGATGTGGAGTTTGTCATTTTTGACGAAGTCCACTATGTCAACGACTTTGAGCGT
GGCGTTGTGTGGGAAGAAGTCATTATCATGCTGCCAGAACATGTGTCTCTCATCTTGCTTTCGGCTACCGTGCCC
AACACGTACGAGTTTGCGTCGTGGGTTGGCCGGACAAAACAAAAGGACATTTATGTCATTTCGACTTCCAAACGC
CCAGTACCTCTTGAGCACTATCTTTGGGTTGCTAATGACATGCACAAGATTGTTGATTCAGACAAGAAGTTTCTC
GAAAGCGGATGGAAGAGCGCTCACAATGCAGTCCAAAAGAAGGACAAGCAGTGGACTGACAACAACAACAACACC
ATGGCAATAAGAGGTGGCAACAATCGGGGTGGTCAGCGAGGTGGCGGCCAAAGAGGCGGCCAGCAACAACGGGGC
GGTGGCCGAGGAGGAGGACCTCGTGGTGGTGGTGGTAATCAGCAACGGGGACGCGGCGGTGGCGGCCCTCCTCGC
GCAAGCCATACTCCAGGCCACATGGGGCGTGGTGGACGAGCAGCAGGAATGGCCTCGGCTGCCCAAGACAGGAAT
CTCTGGGTACACCTGGTGCAGTTTCTCCGGAAAAAGACTCTGCTGCCAGCATGCATCTTTGTCTTTTCCAAGAAG
CGCTGCGAACAGAATGCAGACGCGCTCAGCAACCAGGACTTCTGCACAGCATCGGAAAAGAGCCGCATCCACATT
GTCATTGAAAAGTCGATTGCTCGCCTCAAGCCCGAAGACAGGGTGCTGCCGCAGATTGTCAGGCTGCGCGACCTT
TTGGGCCGAGGCATCGCAGTTCACCACGGCGGTCTTCTACCCATTGTCAAGGAGCTGGTTGAGATTTTGTTTGCA
CAGACCTTGGTCAAGGTGCTATTTGCCACTGAGACTTTTGCCATGGGCCTTAATCTTCCGACGCGAACAGTCGTC
TTTTCAGGCTACCGCAAGCACGACGGCCAGTCGTTTCGCAATCTGCTGCCGGGCGAGTACACGCAAATGGCTGGC
CGGGCTGGGCGACGCGGTCTAGACACGGTCGGCTCGGTTATTCTGGTGCCGCCTGGAGGCACCGATGATGTGCCA
CCCGTCGCTGATCTCCGCAACATGATTCTCGGCGAACCGTCCAAGCTGAGGTCACAGTTTCGCCTCACGTACAAC
ATGATTCTCAACCTGTTACGAGTGGAGGCACTGAAGATTGAGGAGATGATTAAGCGCAGCTTCTCTGAACACGCC
ACTCAGGCCTTGCTCCCCGAGCACGAAAAGGACGTCAAGCTGGCACAGGCAGATTTGGCAAAGATTAAGCGTGAG
GCGTGCCAGATTTGTGACAGTGACATGGACGAGTGCCATCAGGCCGCCCAAGACTTTAAGCAGCTTACGTTCCAG
CTGTACAAGGGCTTGCTGCACATTCCGCTTGGACGCAGAATGTTTGTGTCACAGCGAGTGGTTGTCTTTCAGTGG
GACGGGATCCGCACCATTGGTCTCTTGCTCGCCGACGGCATGAGCCCTCGAGGCTCCACGGACGACCCAATCATT
CAAGTCTGTGCCGTCAAGCCTCTCCGGGACCGGCGCGACGCCAGTGACCAGCTTCCCTTTATCCCAGCCTTTCGC
AAGTACCTCATCAACCTACCTAGCGCGCGGAAGCAAATCCACATGCGGTCGCTGAATGTGCCGCTGCGAGATATC
GAGTGCCTGACGCGGTGGGTGCTAAAGGGAACCGTGCCAGAGATACTCAAGGACGGCCAGGCCGGCCACCAGGCA
GTCGAACGAGTCCAAGAGATTTGTCACTCGTGGGATGACCGGCTGAATGAGTTGGACTTGAGCAGGGTTAAAAGT
CTACACTTGCAAGAAATCAAGGAGAAGCGCACGCAGCTGATGAGCAAGATGCAATCATCACCCGCTGTTTTGTGT
AAAATGTTTCTCAAACACGTAAGTCTATTACTATAG
Gene >OphauG2|7082
ATGCCGAGCATCAACGATTTGCTTGTTTCCGAGGAGGAGGAGGAGGACATATCGTCAAAAACCCCCTTGGCCGAT
TGCAAACGCGAGGATCCAGAAGCACAGAAGAACGAGCTTGAGAAGCAGTTTTTATCACCATGCAGCGATTTTTCA
GCGGAATGGCTCAACCGCCTACAACAGCGATGGGACATTGAGCCCGATTATCGTTCGCTATTTAAAATAGCCCCG
ACTCAGACGCGCACCGTGACGAGGTTTCTGCGCCAGGGACTGCAAGGGCGAGTCGTGGGATATCAAAATATAACG
GTGCCGATGAATAGGTCTACAGCCAAGAACTCGACGTCTTTGCAACGGCAACCTGCTAACAGGGCGGACTTTGTA
CGCGGCGCTGCGGGCTTCTTTCCCTTTACTCCAGGAGGGCTGGATAGTATTGAAGCGACAGCCGCGTTGGAGGAC
CAACTTTACTCTGGCGACAAGCCCGATGGTGATTCAAACGCGAATCGTCTAGACCGAGTGATTCCTTTGGGGTCA
ACGGGGCGTCTACTCGAGATTGCCCCAGGCATGAGCCGCGGCATCGACTTTAGCCTTTCCAACAAGAGCCAAAGC
AAGGCATCGGCCGATGACATTCTGAAGATTCTCGAGCAAGATGCTGAGCAAGAGCCTCGTCAAAAGTTGAATGAG
GCTCTTGCTGCAAATGAGTCGTCGGAAGAGACGACGAATGGCGAAAGCGACTATGACCCAATTGATGAATTCCTA
CCCGTCGAGTTCCCCAGCTTCGAGCCTCACGGCGTTCTGGCTACGTCTAGTGCGAGAAAGACTGGGCGCGAATGG
GCACACATGGTGGACATTCGGCACGGCATGCCCAACTTTGGCGAACTGGTGCCAAACATGGCGCGCGACTGGCCG
TTTGAGCTTGACACGTTTCAAAAAGAAGCCGTCTACCACCTCGAAAACGGCGATTCCGTCTTTGTGGCGGCTCAC
ACATCGGCGGGCAAGACTGTGGTGGCCGAGTATGCTATTGCGTTGGCGGCAAAGCACATGACAAAAGCAATCTAC
ACATCGCCCATAAAGGCACTAAGCAATCAAAAGTTTCGTGATTTCCGCCAAGACTTTAGCGAGGTTGGCATCCTG
ACGGGCGACGTGCAAATAAATCCAGAGGCTAGTTGCCTTATTATGACGACTGAGATTTTACGCAGCATGCTTTAC
CGAGGAGCCGATTTAATACGCGATGTGGAGTTTGTCATTTTTGACGAAGTCCACTATGTCAACGACTTTGAGCGT
GGCGTTGTGTGGGAAGAAGTCATTATCATGCTGCCAGAACATGTGTCTCTCATCTTGCTTTCGGCTACCGTGCCC
AACACGTACGAGTTTGCGTCGTGGGTTGGCCGGACAAAACAAAAGGACATTTATGTCATTTCGACTTCCAAACGC
CCAGTACCTCTTGAGCACTATCTTTGGGTTGCTAATGACATGCACAAGATTGTTGATTCAGACAAGAAGTTTCTC
GAAAGCGGATGGAAGAGCGCTCACAATGCAGTCCAAAAGAAGGACAAGCAGTGGACTGACAACAACAACAACACC
ATGGCAATAAGAGGTGGCAACAATCGGGGTGGTCAGCGAGGTGGCGGCCAAAGAGGCGGCCAGCAACAACGGGGC
GGTGGCCGAGGAGGAGGACCTCGTGGTGGTGGTGGTAATCAGCAACGGGGACGCGGCGGTGGCGGCCCTCCTCGC
GCAAGCCATACTCCAGGCCACATGGGGCGTGGTGGACGAGCAGCAGGAATGGCCTCGGCTGCCCAAGACAGGAAT
CTCTGGGTACACCTGGTGCAGTTTCTCCGGAAAAAGACTCTGCTGCCAGCATGCATCTTTGTCTTTTCCAAGAAG
CGCTGCGAACAGAATGCAGACGCGCTCAGCAACCAGGACTTCTGCACAGCATCGGAAAAGAGCCGCATCCACATT
GTCATTGAAAAGTCGATTGCTCGCCTCAAGCCCGAAGACAGGGTGCTGCCGCAGATTGTCAGGCTGCGCGACCTT
TTGGGCCGAGGCATCGCAGTTCACCACGGCGGTCTTCTACCCATTGTCAAGGAGCTGGTTGAGATTTTGTTTGCA
CAGACCTTGGTCAAGGTGCTATTTGCCACTGAGACTTTTGCCATGGGCCTTAATCTTCCGACGCGAACAGTCGTC
TTTTCAGGCTACCGCAAGCACGACGGCCAGTCGTTTCGCAATCTGCTGCCGGGCGAGTACACGCAAATGGCTGGC
CGGGCTGGGCGACGCGGTCTAGACACGGTCGGCTCGGTTATTCTGGTGCCGCCTGGAGGCACCGATGATGTGCCA
CCCGTCGCTGATCTCCGCAACATGATTCTCGGCGAACCGTCCAAGCTGAGGTCACAGTTTCGCCTCACGTACAAC
ATGATTCTCAACCTGTTACGAGTGGAGGCACTGAAGATTGAGGAGATGATTAAGCGCAGCTTCTCTGAACACGCC
ACTCAGGCCTTGCTCCCCGAGCACGAAAAGGACGTCAAGCTGGCACAGGCAGATTTGGCAAAGATTAAGCGTGAG
GCGTGCCAGATTTGTGACAGTGACATGGACGAGTGCCATCAGGCCGCCCAAGACTTTAAGCAGCTTACGTTCCAG
CTGTACAAGGGCTTGCTGCACATTCCGCTTGGACGCAGAATGTTTGTGTCACAGCGAGTGGTTGTCTTTCAGTGG
GACGGGATCCGCACCATTGGTCTCTTGCTCGCCGACGGCATGAGCCCTCGAGGCTCCACGGACGACCCAATCATT
CAAGTCTGTGCCGTCAAGCCTCTCCGGGACCGGCGCGACGCCAGTGACCAGCTTCCCTTTATCCCAGCCTTTCGC
AAGTACCTCATCAACCTACCTAGCGCGCGGAAGCAAATCCACATGCGGTCGCTGAATGTGCCGCTGCGAGATATC
GAGTGCCTGACGCGGTGGGTGCTAAAGGGAACCGTGCCAGAGATACTCAAGGACGGCCAGGCCGGCCACCAGGCA
GTCGAACGAGTCCAAGAGATTTGTCACTCGTGGGATGACCGGCTGAATGAGTTGGACTTGAGCAGGGTTAAAAGT
CTACACTTGCAAGAAATCAAGGAGAAGCGCACGCAGCTGATGAGCAAGATGCAATCATCACCCGCTGTTTTGTGT
AAAATGTTTCTCAAACACGTAAGTCTATTACTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail