Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|708
Gene name
LocationContig_1180:1292..2897
Strand+
Gene length (bp)1605
Transcript length (bp)1539
Coding sequence length (bp)1539
Protein length (aa) 513

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00615 RGS Regulator of G protein signaling domain 3.7E-35 342 487
PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP) 9.2E-21 223 304

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38093|FLBA_EMENI Developmental regulator flbA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=flbA PE=2 SV=1 22 509 7.0E-176
sp|Q09777|RGS1_SCHPO Regulator of G-protein signaling 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgs1 PE=2 SV=1 23 480 2.0E-32
sp|P11972|SST2_YEAST Protein SST2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SST2 PE=1 SV=2 207 438 1.0E-22
sp|P49802|RGS7_HUMAN Regulator of G-protein signaling 7 OS=Homo sapiens GN=RGS7 PE=1 SV=3 343 490 2.0E-11
sp|O46470|RGS7_BOVIN Regulator of G-protein signaling 7 OS=Bos taurus GN=RGS7 PE=1 SV=1 343 490 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38093|FLBA_EMENI Developmental regulator flbA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=flbA PE=2 SV=1 22 509 7.0E-176
sp|Q09777|RGS1_SCHPO Regulator of G-protein signaling 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgs1 PE=2 SV=1 23 480 2.0E-32
sp|P11972|SST2_YEAST Protein SST2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SST2 PE=1 SV=2 207 438 1.0E-22
sp|P49802|RGS7_HUMAN Regulator of G-protein signaling 7 OS=Homo sapiens GN=RGS7 PE=1 SV=3 343 490 2.0E-11
sp|O46470|RGS7_BOVIN Regulator of G-protein signaling 7 OS=Bos taurus GN=RGS7 PE=1 SV=1 343 490 2.0E-11
sp|P49803|RGS7_RAT Regulator of G-protein signaling 7 OS=Rattus norvegicus GN=Rgs7 PE=1 SV=2 343 490 4.0E-11
sp|O54829|RGS7_MOUSE Regulator of G-protein signaling 7 OS=Mus musculus GN=Rgs7 PE=1 SV=2 343 490 5.0E-11
sp|P34295|RGS1_CAEEL Regulator of G-protein signaling rgs-1 OS=Caenorhabditis elegans GN=rgs-1 PE=2 SV=3 338 493 5.0E-08
sp|P49758|RGS6_HUMAN Regulator of G-protein signaling 6 OS=Homo sapiens GN=RGS6 PE=1 SV=5 334 488 7.0E-08
sp|Q9PWA1|RGS20_CHICK Regulator of G-protein signaling 20 OS=Gallus gallus GN=RGS20 PE=2 SV=1 325 490 9.0E-08
sp|Q9Z2H2|RGS6_MOUSE Regulator of G-protein signaling 6 OS=Mus musculus GN=Rgs6 PE=1 SV=2 334 488 1.0E-07
sp|Q8K443|RGS13_MOUSE Regulator of G-protein signaling 13 OS=Mus musculus GN=Rgs13 PE=1 SV=1 405 490 2.0E-07
sp|Q08DC7|RGS19_BOVIN Regulator of G-protein signaling 19 OS=Bos taurus GN=RGS19 PE=2 SV=1 338 488 2.0E-07
sp|Q9PWA0|RGS17_CHICK Regulator of G-protein signaling 17 OS=Gallus gallus GN=RGS17 PE=2 SV=1 338 490 2.0E-07
sp|Q5M8L6|RGS1_XENTR Regulator of G-protein signaling 1 OS=Xenopus tropicalis GN=rgs1 PE=2 SV=2 340 487 4.0E-07
sp|Q9QZB0|RGS17_MOUSE Regulator of G-protein signaling 17 OS=Mus musculus GN=Rgs17 PE=1 SV=1 338 490 5.0E-07
sp|O14921|RGS13_HUMAN Regulator of G-protein signaling 13 OS=Homo sapiens GN=RGS13 PE=2 SV=1 354 490 6.0E-07
sp|Q9UGC6|RGS17_HUMAN Regulator of G-protein signaling 17 OS=Homo sapiens GN=RGS17 PE=1 SV=2 338 490 7.0E-07
sp|P79348|RGS20_BOVIN Regulator of G-protein signaling 20 OS=Bos taurus GN=RGS20 PE=1 SV=2 340 490 9.0E-07
sp|O15539|RGS5_HUMAN Regulator of G-protein signaling 5 OS=Homo sapiens GN=RGS5 PE=1 SV=1 323 489 1.0E-06
sp|O76081|RGS20_HUMAN Regulator of G-protein signaling 20 OS=Homo sapiens GN=RGS20 PE=1 SV=4 325 490 1.0E-06
sp|P49795|RGS19_HUMAN Regulator of G-protein signaling 19 OS=Homo sapiens GN=RGS19 PE=1 SV=1 338 488 1.0E-06
sp|Q9QZB1|RGS20_MOUSE Regulator of G-protein signaling 20 OS=Mus musculus GN=Rgs20 PE=1 SV=1 341 490 2.0E-06
sp|Q2M5E4|RGS21_HUMAN Regulator of G-protein signaling 21 OS=Homo sapiens GN=RGS21 PE=2 SV=1 340 498 2.0E-06
sp|P11972|SST2_YEAST Protein SST2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SST2 PE=1 SV=2 55 210 4.0E-06
sp|Q3S853|RGS2_PIG Regulator of G-protein signaling 2 OS=Sus scrofa GN=RGS2 PE=2 SV=2 356 489 4.0E-06
sp|Q0P5H5|RGS2_BOVIN Regulator of G-protein signaling 2 OS=Bos taurus GN=RGS2 PE=2 SV=1 340 489 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0035556 intracellular signal transduction Yes
GO:0050789 regulation of biological process No
GO:0007165 signal transduction No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|708
MKPAQAPAVAQFINLDLACVSNKPIKQDFKDLFATLIVSLLPLTPHRVRLSKVDYTFLSEDAINNLGSLKFSQSN
RMPDPKDSSRIVTTTTTTTFSMAKDMARTICQRFVEARFIESADGKYQQHYSMKGSVWQLTPKGVTVLDRFCARN
GIQQKQVAELVSINSAQLVILERDMMSDKLLSDVGTIEVIFRRFVGADGRNVKSSTTAADSDSLHDYKDGLTGVK
MAAERKVNGRIYRDTFTGRATTDWLMDCSTIVDRRETVEIATLFVEYGLIEPVVPDRAFMSQNTGYNLFQPTKYA
IYQLTQQGRDLINGALSRGRVSRNEGPASTRNGISRDSNTQRLDRILNDPALRLLFRENLRDTHCEENLSFHQDV
AEFVRACKVAIAYARKSPSENSMEGIKEIMAQAYGIYNAFLAPGSPCELNIDHQLRNNLATRMTKAIGQDTSMIE
SLEEVTTLFEDAQNAVFKLMASDSVPKFLRNTKYEQLLRSYDLDPNGRGLERSQSRSNQQQI*
Coding >OphauG2|708
ATGAAGCCTGCACAAGCTCCTGCAGTTGCACAGTTTATAAACCTCGACCTCGCTTGCGTCTCTAACAAGCCAATC
AAACAGGACTTTAAAGATCTTTTTGCAACGCTCATCGTGAGCCTGTTGCCTCTCACACCTCACCGTGTCCGCCTG
TCCAAAGTCGACTATACTTTTCTCTCCGAAGATGCCATTAACAATCTCGGATCTCTCAAATTCTCGCAATCCAAT
CGCATGCCCGATCCCAAGGATTCTTCGCGTATTGTCACGACCACGACTACAACCACTTTCTCCATGGCAAAGGAC
ATGGCCAGGACAATCTGTCAACGGTTTGTAGAGGCCCGCTTCATCGAGTCGGCCGACGGCAAGTATCAGCAGCAC
TACAGCATGAAGGGATCCGTCTGGCAACTCACACCAAAAGGTGTCACGGTACTTGATAGGTTTTGTGCCCGCAAT
GGTATCCAGCAAAAGCAGGTGGCCGAGCTTGTGAGCATCAATTCTGCCCAGCTCGTGATTCTTGAGCGCGACATG
ATGTCGGATAAGCTGCTCAGCGATGTCGGCACCATTGAGGTCATTTTTCGGAGATTTGTCGGCGCCGATGGCCGT
AACGTCAAGAGTTCGACGACAGCCGCCGATTCCGACTCGCTGCATGACTACAAGGATGGTCTTACCGGCGTCAAG
ATGGCAGCCGAGCGCAAGGTTAATGGCAGAATATACCGCGACACCTTTACTGGCAGAGCAACGACGGATTGGCTA
ATGGATTGCTCCACCATTGTCGACCGGCGAGAGACTGTTGAGATTGCCACTCTCTTTGTCGAGTATGGCCTCATT
GAACCCGTGGTGCCTGACCGAGCTTTCATGTCGCAAAACACGGGATATAATCTCTTCCAGCCCACGAAATATGCC
ATTTACCAATTGACGCAACAAGGCAGAGATCTCATCAATGGTGCCTTGTCAAGAGGCCGTGTTTCTAGGAATGAG
GGTCCTGCGTCTACGCGCAATGGTATTAGCAGGGATTCCAACACACAACGCCTTGATCGCATCCTCAATGATCCC
GCTCTGCGCCTATTGTTCCGCGAGAATCTACGCGATACACATTGCGAGGAGAACCTGTCATTTCACCAAGACGTG
GCCGAATTTGTTCGTGCTTGCAAGGTGGCAATTGCCTATGCTCGCAAGTCTCCGTCAGAAAACTCCATGGAAGGT
ATCAAGGAAATCATGGCGCAGGCCTATGGCATTTACAATGCCTTTTTGGCTCCGGGATCACCGTGCGAGCTCAAT
ATTGATCACCAGCTACGCAACAATCTGGCTACTCGCATGACCAAGGCCATAGGGCAAGACACGTCGATGATTGAG
TCACTTGAAGAAGTGACAACCTTGTTTGAAGACGCTCAGAATGCAGTATTCAAGCTGATGGCTAGCGATTCGGTG
CCTAAATTTCTGCGAAACACAAAGTACGAGCAACTGTTGCGGAGCTACGATCTCGACCCCAACGGACGGGGGCTC
GAACGAAGCCAAAGCCGCTCGAACCAGCAGCAAATATAG
Transcript >OphauG2|708
ATGAAGCCTGCACAAGCTCCTGCAGTTGCACAGTTTATAAACCTCGACCTCGCTTGCGTCTCTAACAAGCCAATC
AAACAGGACTTTAAAGATCTTTTTGCAACGCTCATCGTGAGCCTGTTGCCTCTCACACCTCACCGTGTCCGCCTG
TCCAAAGTCGACTATACTTTTCTCTCCGAAGATGCCATTAACAATCTCGGATCTCTCAAATTCTCGCAATCCAAT
CGCATGCCCGATCCCAAGGATTCTTCGCGTATTGTCACGACCACGACTACAACCACTTTCTCCATGGCAAAGGAC
ATGGCCAGGACAATCTGTCAACGGTTTGTAGAGGCCCGCTTCATCGAGTCGGCCGACGGCAAGTATCAGCAGCAC
TACAGCATGAAGGGATCCGTCTGGCAACTCACACCAAAAGGTGTCACGGTACTTGATAGGTTTTGTGCCCGCAAT
GGTATCCAGCAAAAGCAGGTGGCCGAGCTTGTGAGCATCAATTCTGCCCAGCTCGTGATTCTTGAGCGCGACATG
ATGTCGGATAAGCTGCTCAGCGATGTCGGCACCATTGAGGTCATTTTTCGGAGATTTGTCGGCGCCGATGGCCGT
AACGTCAAGAGTTCGACGACAGCCGCCGATTCCGACTCGCTGCATGACTACAAGGATGGTCTTACCGGCGTCAAG
ATGGCAGCCGAGCGCAAGGTTAATGGCAGAATATACCGCGACACCTTTACTGGCAGAGCAACGACGGATTGGCTA
ATGGATTGCTCCACCATTGTCGACCGGCGAGAGACTGTTGAGATTGCCACTCTCTTTGTCGAGTATGGCCTCATT
GAACCCGTGGTGCCTGACCGAGCTTTCATGTCGCAAAACACGGGATATAATCTCTTCCAGCCCACGAAATATGCC
ATTTACCAATTGACGCAACAAGGCAGAGATCTCATCAATGGTGCCTTGTCAAGAGGCCGTGTTTCTAGGAATGAG
GGTCCTGCGTCTACGCGCAATGGTATTAGCAGGGATTCCAACACACAACGCCTTGATCGCATCCTCAATGATCCC
GCTCTGCGCCTATTGTTCCGCGAGAATCTACGCGATACACATTGCGAGGAGAACCTGTCATTTCACCAAGACGTG
GCCGAATTTGTTCGTGCTTGCAAGGTGGCAATTGCCTATGCTCGCAAGTCTCCGTCAGAAAACTCCATGGAAGGT
ATCAAGGAAATCATGGCGCAGGCCTATGGCATTTACAATGCCTTTTTGGCTCCGGGATCACCGTGCGAGCTCAAT
ATTGATCACCAGCTACGCAACAATCTGGCTACTCGCATGACCAAGGCCATAGGGCAAGACACGTCGATGATTGAG
TCACTTGAAGAAGTGACAACCTTGTTTGAAGACGCTCAGAATGCAGTATTCAAGCTGATGGCTAGCGATTCGGTG
CCTAAATTTCTGCGAAACACAAAGTACGAGCAACTGTTGCGGAGCTACGATCTCGACCCCAACGGACGGGGGCTC
GAACGAAGCCAAAGCCGCTCGAACCAGCAGCAAATATAG
Gene >OphauG2|708
ATGAAGCCTGCACAAGCTCCTGCAGTTGCACAGTTTATAAACCTCGACCTCGCTTGCGTCTCTAACAAGCCAATC
AAACAGGACTTTAAAGATCTTTTTGCAACGCTCATCGTGAGCCTGTTGCCTCTCACACCTCACCGTGTCCGCCTG
TCCAAAGTCGACTATACTTTTCTCTCCGAAGATGCCATTAACAATCTCGGATCTCTCAAATTCTCGCAATCCAAT
CGCATGCCCGATCCCAAGGATTCTTCGCGTATTGTCACGACCACGACTACAACCACTTTCTCCATGGCAAAGGAC
ATGGCCAGGACAATCTGTCAACGGTTTGTAGAGGCCCGCTTCATCGAGTCGGCCGACGGCAAGTATCAGCAGCAC
TACAGCATGAAGGGATCCGTCTGGCAACTCACACCAAAAGGTGTCACGGTACTTGATAGGTTTTGTGCCCGCAAT
GGTATCCAGCAAAAGCAGGTGGCCGAGCTTGTGAGCATCAATTCTGCCCAGCTCGTGATTCTTGAGCGCGACATG
ATGTCGGATAAGCTGCTCAGCGATGTCGGCACCATTGAGGTCATTTTTCGGAGATTTGTCGGCGCCGATGGCCGT
AACGTCAAGAGTTCGACGACAGCCGCCGATTCCGACTCGCTGCATGACTACAAGGATGGTCTTACCGGCGTCAAG
ATGGCAGCCGAGCGCAAGGTTAATGGCAGAATATACCGCGACACCTTTACTGGCAGAGCAACGACGGATTGGCTA
ATGGATTGCTCCACCATTGTCGACCGGCGAGAGACTGTTGAGATTGCCACTCTCTTTGTCGAGTATGGCCTCATT
GAACCCGTGGTGCCTGACCGAGCTTTCATGTCGCAAAACACGGGATATAATCTCTTCCAGCCCACGAAATATGCC
ATTTACCAATTGACGCAACAAGGCAGAGATCTCATCAATGGTGCCTTGTCAAGAGGCCGTGTTTCTAGGAATGAG
GGTCCTGCGTCTACGCGCAATGGTATTAGCAGGGATTCCAACACACAACGCCTTGATCGCATCCTCAATGATCCC
GCTCTGCGCCTATTGTTCCGCGAGAATCTACGCGATACACATTGCGAGGAGAACCTGTCATTTCACCAAGACGTG
GCCGAATTTGTTCGTGCTTGCAAGGTGGCAATTGCCTATGCTCGCAAGTCTCCGTCAGAAAACTCCATGGAAGGT
ATCAAGGAAATCATGGCGCAGGCCTATGGCATTTACAATGCCTTTTTGGCTCCGGGATCACCGTGCGAGCTCAAT
ATTGATCACCAGCTACGCAACAATCTGGCTACTCGCATGACCAAGGCCATAGGGCAAGACACGTCGATGATTGAG
TCACTTGAAGAAGTGACAACCTTGTTTGAAGACGCTCAGAATGCAGTATTCAAGCTGATGGCTAGCGTACGTTGA
TTAATTCTGCTCTTATGCCGCTTATATGGGACATGAGTTAACATGAGATTTGAATAGGATTCGGTGCCTAAATTT
CTGCGAAACACAAAGTACGAGCAACTGTTGCGGAGCTACGATCTCGACCCCAACGGACGGGGGCTCGAACGAAGC
CAAAGCCGCTCGAACCAGCAGCAAATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail