Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|708
Gene name
LocationContig_1180:1292..2897
Strand+
Gene length (bp)1605
Transcript length (bp)1539
Coding sequence length (bp)1539
Protein length (aa) 513

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00615 RGS Regulator of G protein signaling domain 3.7E-35 342 487
PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP) 9.2E-21 223 304

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38093|FLBA_EMENI Developmental regulator flbA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=flbA PE=2 SV=1 22 509 7.0E-176
sp|Q09777|RGS1_SCHPO Regulator of G-protein signaling 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgs1 PE=2 SV=1 23 480 2.0E-32
sp|P11972|SST2_YEAST Protein SST2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SST2 PE=1 SV=2 207 438 1.0E-22
sp|P49802|RGS7_HUMAN Regulator of G-protein signaling 7 OS=Homo sapiens GN=RGS7 PE=1 SV=3 343 490 2.0E-11
sp|O46470|RGS7_BOVIN Regulator of G-protein signaling 7 OS=Bos taurus GN=RGS7 PE=1 SV=1 343 490 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38093|FLBA_EMENI Developmental regulator flbA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=flbA PE=2 SV=1 22 509 7.0E-176
sp|Q09777|RGS1_SCHPO Regulator of G-protein signaling 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgs1 PE=2 SV=1 23 480 2.0E-32
sp|P11972|SST2_YEAST Protein SST2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SST2 PE=1 SV=2 207 438 1.0E-22
sp|P49802|RGS7_HUMAN Regulator of G-protein signaling 7 OS=Homo sapiens GN=RGS7 PE=1 SV=3 343 490 2.0E-11
sp|O46470|RGS7_BOVIN Regulator of G-protein signaling 7 OS=Bos taurus GN=RGS7 PE=1 SV=1 343 490 2.0E-11
sp|P49803|RGS7_RAT Regulator of G-protein signaling 7 OS=Rattus norvegicus GN=Rgs7 PE=1 SV=2 343 490 4.0E-11
sp|O54829|RGS7_MOUSE Regulator of G-protein signaling 7 OS=Mus musculus GN=Rgs7 PE=1 SV=2 343 490 5.0E-11
sp|P34295|RGS1_CAEEL Regulator of G-protein signaling rgs-1 OS=Caenorhabditis elegans GN=rgs-1 PE=2 SV=3 338 493 5.0E-08
sp|P49758|RGS6_HUMAN Regulator of G-protein signaling 6 OS=Homo sapiens GN=RGS6 PE=1 SV=5 334 488 7.0E-08
sp|Q9PWA1|RGS20_CHICK Regulator of G-protein signaling 20 OS=Gallus gallus GN=RGS20 PE=2 SV=1 325 490 9.0E-08
sp|Q9Z2H2|RGS6_MOUSE Regulator of G-protein signaling 6 OS=Mus musculus GN=Rgs6 PE=1 SV=2 334 488 1.0E-07
sp|Q8K443|RGS13_MOUSE Regulator of G-protein signaling 13 OS=Mus musculus GN=Rgs13 PE=1 SV=1 405 490 2.0E-07
sp|Q08DC7|RGS19_BOVIN Regulator of G-protein signaling 19 OS=Bos taurus GN=RGS19 PE=2 SV=1 338 488 2.0E-07
sp|Q9PWA0|RGS17_CHICK Regulator of G-protein signaling 17 OS=Gallus gallus GN=RGS17 PE=2 SV=1 338 490 2.0E-07
sp|Q5M8L6|RGS1_XENTR Regulator of G-protein signaling 1 OS=Xenopus tropicalis GN=rgs1 PE=2 SV=2 340 487 4.0E-07
sp|Q9QZB0|RGS17_MOUSE Regulator of G-protein signaling 17 OS=Mus musculus GN=Rgs17 PE=1 SV=1 338 490 5.0E-07
sp|O14921|RGS13_HUMAN Regulator of G-protein signaling 13 OS=Homo sapiens GN=RGS13 PE=2 SV=1 354 490 6.0E-07
sp|Q9UGC6|RGS17_HUMAN Regulator of G-protein signaling 17 OS=Homo sapiens GN=RGS17 PE=1 SV=2 338 490 7.0E-07
sp|P79348|RGS20_BOVIN Regulator of G-protein signaling 20 OS=Bos taurus GN=RGS20 PE=1 SV=2 340 490 9.0E-07
sp|O15539|RGS5_HUMAN Regulator of G-protein signaling 5 OS=Homo sapiens GN=RGS5 PE=1 SV=1 323 489 1.0E-06
sp|O76081|RGS20_HUMAN Regulator of G-protein signaling 20 OS=Homo sapiens GN=RGS20 PE=1 SV=4 325 490 1.0E-06
sp|P49795|RGS19_HUMAN Regulator of G-protein signaling 19 OS=Homo sapiens GN=RGS19 PE=1 SV=1 338 488 1.0E-06
sp|Q9QZB1|RGS20_MOUSE Regulator of G-protein signaling 20 OS=Mus musculus GN=Rgs20 PE=1 SV=1 341 490 2.0E-06
sp|Q2M5E4|RGS21_HUMAN Regulator of G-protein signaling 21 OS=Homo sapiens GN=RGS21 PE=2 SV=1 340 498 2.0E-06
sp|P11972|SST2_YEAST Protein SST2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SST2 PE=1 SV=2 55 210 4.0E-06
sp|Q3S853|RGS2_PIG Regulator of G-protein signaling 2 OS=Sus scrofa GN=RGS2 PE=2 SV=2 356 489 4.0E-06
sp|Q0P5H5|RGS2_BOVIN Regulator of G-protein signaling 2 OS=Bos taurus GN=RGS2 PE=2 SV=1 340 489 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0035556 intracellular signal transduction Yes
GO:0050789 regulation of biological process No
GO:0007165 signal transduction No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1983
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|708 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5202
Ophiocordyceps camponoti-floridani Ophcf2|02810
Ophiocordyceps camponoti-rufipedis Ophun1|138
Ophiocordyceps kimflemingae Ophio5|8508
Ophiocordyceps subramaniannii Hirsu2|2183

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|708
MKPAQAPAVAQFINLDLACVSNKPIKQDFKDLFATLIVSLLPLTPHRVRLSKVDYTFLSEDAINNLGSLKFSQSN
RMPDPKDSSRIVTTTTTTTFSMAKDMARTICQRFVEARFIESADGKYQQHYSMKGSVWQLTPKGVTVLDRFCARN
GIQQKQVAELVSINSAQLVILERDMMSDKLLSDVGTIEVIFRRFVGADGRNVKSSTTAADSDSLHDYKDGLTGVK
MAAERKVNGRIYRDTFTGRATTDWLMDCSTIVDRRETVEIATLFVEYGLIEPVVPDRAFMSQNTGYNLFQPTKYA
IYQLTQQGRDLINGALSRGRVSRNEGPASTRNGISRDSNTQRLDRILNDPALRLLFRENLRDTHCEENLSFHQDV
AEFVRACKVAIAYARKSPSENSMEGIKEIMAQAYGIYNAFLAPGSPCELNIDHQLRNNLATRMTKAIGQDTSMIE
SLEEVTTLFEDAQNAVFKLMASDSVPKFLRNTKYEQLLRSYDLDPNGRGLERSQSRSNQQQI*
Coding >OphauG2|708
ATGAAGCCTGCACAAGCTCCTGCAGTTGCACAGTTTATAAACCTCGACCTCGCTTGCGTCTCTAACAAGCCAATC
AAACAGGACTTTAAAGATCTTTTTGCAACGCTCATCGTGAGCCTGTTGCCTCTCACACCTCACCGTGTCCGCCTG
TCCAAAGTCGACTATACTTTTCTCTCCGAAGATGCCATTAACAATCTCGGATCTCTCAAATTCTCGCAATCCAAT
CGCATGCCCGATCCCAAGGATTCTTCGCGTATTGTCACGACCACGACTACAACCACTTTCTCCATGGCAAAGGAC
ATGGCCAGGACAATCTGTCAACGGTTTGTAGAGGCCCGCTTCATCGAGTCGGCCGACGGCAAGTATCAGCAGCAC
TACAGCATGAAGGGATCCGTCTGGCAACTCACACCAAAAGGTGTCACGGTACTTGATAGGTTTTGTGCCCGCAAT
GGTATCCAGCAAAAGCAGGTGGCCGAGCTTGTGAGCATCAATTCTGCCCAGCTCGTGATTCTTGAGCGCGACATG
ATGTCGGATAAGCTGCTCAGCGATGTCGGCACCATTGAGGTCATTTTTCGGAGATTTGTCGGCGCCGATGGCCGT
AACGTCAAGAGTTCGACGACAGCCGCCGATTCCGACTCGCTGCATGACTACAAGGATGGTCTTACCGGCGTCAAG
ATGGCAGCCGAGCGCAAGGTTAATGGCAGAATATACCGCGACACCTTTACTGGCAGAGCAACGACGGATTGGCTA
ATGGATTGCTCCACCATTGTCGACCGGCGAGAGACTGTTGAGATTGCCACTCTCTTTGTCGAGTATGGCCTCATT
GAACCCGTGGTGCCTGACCGAGCTTTCATGTCGCAAAACACGGGATATAATCTCTTCCAGCCCACGAAATATGCC
ATTTACCAATTGACGCAACAAGGCAGAGATCTCATCAATGGTGCCTTGTCAAGAGGCCGTGTTTCTAGGAATGAG
GGTCCTGCGTCTACGCGCAATGGTATTAGCAGGGATTCCAACACACAACGCCTTGATCGCATCCTCAATGATCCC
GCTCTGCGCCTATTGTTCCGCGAGAATCTACGCGATACACATTGCGAGGAGAACCTGTCATTTCACCAAGACGTG
GCCGAATTTGTTCGTGCTTGCAAGGTGGCAATTGCCTATGCTCGCAAGTCTCCGTCAGAAAACTCCATGGAAGGT
ATCAAGGAAATCATGGCGCAGGCCTATGGCATTTACAATGCCTTTTTGGCTCCGGGATCACCGTGCGAGCTCAAT
ATTGATCACCAGCTACGCAACAATCTGGCTACTCGCATGACCAAGGCCATAGGGCAAGACACGTCGATGATTGAG
TCACTTGAAGAAGTGACAACCTTGTTTGAAGACGCTCAGAATGCAGTATTCAAGCTGATGGCTAGCGATTCGGTG
CCTAAATTTCTGCGAAACACAAAGTACGAGCAACTGTTGCGGAGCTACGATCTCGACCCCAACGGACGGGGGCTC
GAACGAAGCCAAAGCCGCTCGAACCAGCAGCAAATATAG
Transcript >OphauG2|708
ATGAAGCCTGCACAAGCTCCTGCAGTTGCACAGTTTATAAACCTCGACCTCGCTTGCGTCTCTAACAAGCCAATC
AAACAGGACTTTAAAGATCTTTTTGCAACGCTCATCGTGAGCCTGTTGCCTCTCACACCTCACCGTGTCCGCCTG
TCCAAAGTCGACTATACTTTTCTCTCCGAAGATGCCATTAACAATCTCGGATCTCTCAAATTCTCGCAATCCAAT
CGCATGCCCGATCCCAAGGATTCTTCGCGTATTGTCACGACCACGACTACAACCACTTTCTCCATGGCAAAGGAC
ATGGCCAGGACAATCTGTCAACGGTTTGTAGAGGCCCGCTTCATCGAGTCGGCCGACGGCAAGTATCAGCAGCAC
TACAGCATGAAGGGATCCGTCTGGCAACTCACACCAAAAGGTGTCACGGTACTTGATAGGTTTTGTGCCCGCAAT
GGTATCCAGCAAAAGCAGGTGGCCGAGCTTGTGAGCATCAATTCTGCCCAGCTCGTGATTCTTGAGCGCGACATG
ATGTCGGATAAGCTGCTCAGCGATGTCGGCACCATTGAGGTCATTTTTCGGAGATTTGTCGGCGCCGATGGCCGT
AACGTCAAGAGTTCGACGACAGCCGCCGATTCCGACTCGCTGCATGACTACAAGGATGGTCTTACCGGCGTCAAG
ATGGCAGCCGAGCGCAAGGTTAATGGCAGAATATACCGCGACACCTTTACTGGCAGAGCAACGACGGATTGGCTA
ATGGATTGCTCCACCATTGTCGACCGGCGAGAGACTGTTGAGATTGCCACTCTCTTTGTCGAGTATGGCCTCATT
GAACCCGTGGTGCCTGACCGAGCTTTCATGTCGCAAAACACGGGATATAATCTCTTCCAGCCCACGAAATATGCC
ATTTACCAATTGACGCAACAAGGCAGAGATCTCATCAATGGTGCCTTGTCAAGAGGCCGTGTTTCTAGGAATGAG
GGTCCTGCGTCTACGCGCAATGGTATTAGCAGGGATTCCAACACACAACGCCTTGATCGCATCCTCAATGATCCC
GCTCTGCGCCTATTGTTCCGCGAGAATCTACGCGATACACATTGCGAGGAGAACCTGTCATTTCACCAAGACGTG
GCCGAATTTGTTCGTGCTTGCAAGGTGGCAATTGCCTATGCTCGCAAGTCTCCGTCAGAAAACTCCATGGAAGGT
ATCAAGGAAATCATGGCGCAGGCCTATGGCATTTACAATGCCTTTTTGGCTCCGGGATCACCGTGCGAGCTCAAT
ATTGATCACCAGCTACGCAACAATCTGGCTACTCGCATGACCAAGGCCATAGGGCAAGACACGTCGATGATTGAG
TCACTTGAAGAAGTGACAACCTTGTTTGAAGACGCTCAGAATGCAGTATTCAAGCTGATGGCTAGCGATTCGGTG
CCTAAATTTCTGCGAAACACAAAGTACGAGCAACTGTTGCGGAGCTACGATCTCGACCCCAACGGACGGGGGCTC
GAACGAAGCCAAAGCCGCTCGAACCAGCAGCAAATATAG
Gene >OphauG2|708
ATGAAGCCTGCACAAGCTCCTGCAGTTGCACAGTTTATAAACCTCGACCTCGCTTGCGTCTCTAACAAGCCAATC
AAACAGGACTTTAAAGATCTTTTTGCAACGCTCATCGTGAGCCTGTTGCCTCTCACACCTCACCGTGTCCGCCTG
TCCAAAGTCGACTATACTTTTCTCTCCGAAGATGCCATTAACAATCTCGGATCTCTCAAATTCTCGCAATCCAAT
CGCATGCCCGATCCCAAGGATTCTTCGCGTATTGTCACGACCACGACTACAACCACTTTCTCCATGGCAAAGGAC
ATGGCCAGGACAATCTGTCAACGGTTTGTAGAGGCCCGCTTCATCGAGTCGGCCGACGGCAAGTATCAGCAGCAC
TACAGCATGAAGGGATCCGTCTGGCAACTCACACCAAAAGGTGTCACGGTACTTGATAGGTTTTGTGCCCGCAAT
GGTATCCAGCAAAAGCAGGTGGCCGAGCTTGTGAGCATCAATTCTGCCCAGCTCGTGATTCTTGAGCGCGACATG
ATGTCGGATAAGCTGCTCAGCGATGTCGGCACCATTGAGGTCATTTTTCGGAGATTTGTCGGCGCCGATGGCCGT
AACGTCAAGAGTTCGACGACAGCCGCCGATTCCGACTCGCTGCATGACTACAAGGATGGTCTTACCGGCGTCAAG
ATGGCAGCCGAGCGCAAGGTTAATGGCAGAATATACCGCGACACCTTTACTGGCAGAGCAACGACGGATTGGCTA
ATGGATTGCTCCACCATTGTCGACCGGCGAGAGACTGTTGAGATTGCCACTCTCTTTGTCGAGTATGGCCTCATT
GAACCCGTGGTGCCTGACCGAGCTTTCATGTCGCAAAACACGGGATATAATCTCTTCCAGCCCACGAAATATGCC
ATTTACCAATTGACGCAACAAGGCAGAGATCTCATCAATGGTGCCTTGTCAAGAGGCCGTGTTTCTAGGAATGAG
GGTCCTGCGTCTACGCGCAATGGTATTAGCAGGGATTCCAACACACAACGCCTTGATCGCATCCTCAATGATCCC
GCTCTGCGCCTATTGTTCCGCGAGAATCTACGCGATACACATTGCGAGGAGAACCTGTCATTTCACCAAGACGTG
GCCGAATTTGTTCGTGCTTGCAAGGTGGCAATTGCCTATGCTCGCAAGTCTCCGTCAGAAAACTCCATGGAAGGT
ATCAAGGAAATCATGGCGCAGGCCTATGGCATTTACAATGCCTTTTTGGCTCCGGGATCACCGTGCGAGCTCAAT
ATTGATCACCAGCTACGCAACAATCTGGCTACTCGCATGACCAAGGCCATAGGGCAAGACACGTCGATGATTGAG
TCACTTGAAGAAGTGACAACCTTGTTTGAAGACGCTCAGAATGCAGTATTCAAGCTGATGGCTAGCGTACGTTGA
TTAATTCTGCTCTTATGCCGCTTATATGGGACATGAGTTAACATGAGATTTGAATAGGATTCGGTGCCTAAATTT
CTGCGAAACACAAAGTACGAGCAACTGTTGCGGAGCTACGATCTCGACCCCAACGGACGGGGGCTCGAACGAAGC
CAAAGCCGCTCGAACCAGCAGCAAATATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail