Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7076
Gene name
LocationContig_79:23239..23944
Strand+
Gene length (bp)705
Transcript length (bp)705
Coding sequence length (bp)705
Protein length (aa) 235

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4964
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7076 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|460
Ophiocordyceps camponoti-floridani Ophcf2|02966
Ophiocordyceps camponoti-rufipedis Ophun1|6309
Ophiocordyceps subramaniannii Hirsu2|2023

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7076
MAPAIPHIHLLCMNKDHLAAFTTASTTLRLPSSITVEPHVCPLKQLPPSTRIDLIVSPANSYGRLDGGFDDAISR
ALSPRTDYLALTRAAQHTLYRRWHGFAPPGTCTLVRVPDDFSSQSANVWGVRHVALCPTMRVPADVTWDREVVYE
AAWSLLCAVHQHNAGALEADAIGSLLVTPLATGVGRVSADRWAGQFVLALKHFDDATKNPGKWSCLDPSDILAYS
SEVAKTWKT*
Coding >OphauG2|7076
ATGGCGCCCGCTATCCCACACATCCATCTCCTCTGCATGAACAAAGACCACCTCGCCGCCTTTACCACCGCCTCG
ACGACTCTCCGCCTCCCGTCCAGCATCACCGTCGAGCCTCATGTCTGCCCCCTCAAGCAACTCCCCCCCTCGACG
CGCATCGACCTCATCGTCTCGCCCGCAAACTCGTACGGCCGGCTTGACGGCGGCTTCGACGATGCCATTTCGCGC
GCCCTCTCGCCGCGCACCGACTACCTCGCCCTGACGCGCGCTGCGCAACACACGCTCTACCGCCGCTGGCACGGC
TTCGCTCCCCCAGGCACGTGTACGCTGGTGCGCGTGCCCGACGACTTCTCCTCGCAGTCGGCAAACGTCTGGGGC
GTGCGCCACGTCGCGCTGTGTCCGACGATGCGTGTCCCGGCCGACGTCACCTGGGACCGCGAGGTGGTGTACGAG
GCGGCCTGGAGCCTCTTGTGCGCCGTGCACCAGCATAATGCAGGTGCCCTGGAAGCGGATGCCATTGGAAGCTTG
CTCGTCACGCCGCTGGCTACCGGCGTGGGCCGCGTCAGTGCTGACCGCTGGGCTGGGCAATTCGTCTTGGCGCTC
AAGCATTTCGACGATGCCACCAAGAACCCGGGGAAATGGTCCTGTCTCGATCCATCCGATATTTTGGCATATTCA
TCCGAGGTTGCCAAGACGTGGAAGACGTGA
Transcript >OphauG2|7076
ATGGCGCCCGCTATCCCACACATCCATCTCCTCTGCATGAACAAAGACCACCTCGCCGCCTTTACCACCGCCTCG
ACGACTCTCCGCCTCCCGTCCAGCATCACCGTCGAGCCTCATGTCTGCCCCCTCAAGCAACTCCCCCCCTCGACG
CGCATCGACCTCATCGTCTCGCCCGCAAACTCGTACGGCCGGCTTGACGGCGGCTTCGACGATGCCATTTCGCGC
GCCCTCTCGCCGCGCACCGACTACCTCGCCCTGACGCGCGCTGCGCAACACACGCTCTACCGCCGCTGGCACGGC
TTCGCTCCCCCAGGCACGTGTACGCTGGTGCGCGTGCCCGACGACTTCTCCTCGCAGTCGGCAAACGTCTGGGGC
GTGCGCCACGTCGCGCTGTGTCCGACGATGCGTGTCCCGGCCGACGTCACCTGGGACCGCGAGGTGGTGTACGAG
GCGGCCTGGAGCCTCTTGTGCGCCGTGCACCAGCATAATGCAGGTGCCCTGGAAGCGGATGCCATTGGAAGCTTG
CTCGTCACGCCGCTGGCTACCGGCGTGGGCCGCGTCAGTGCTGACCGCTGGGCTGGGCAATTCGTCTTGGCGCTC
AAGCATTTCGACGATGCCACCAAGAACCCGGGGAAATGGTCCTGTCTCGATCCATCCGATATTTTGGCATATTCA
TCCGAGGTTGCCAAGACGTGGAAGACGTGA
Gene >OphauG2|7076
ATGGCGCCCGCTATCCCACACATCCATCTCCTCTGCATGAACAAAGACCACCTCGCCGCCTTTACCACCGCCTCG
ACGACTCTCCGCCTCCCGTCCAGCATCACCGTCGAGCCTCATGTCTGCCCCCTCAAGCAACTCCCCCCCTCGACG
CGCATCGACCTCATCGTCTCGCCCGCAAACTCGTACGGCCGGCTTGACGGCGGCTTCGACGATGCCATTTCGCGC
GCCCTCTCGCCGCGCACCGACTACCTCGCCCTGACGCGCGCTGCGCAACACACGCTCTACCGCCGCTGGCACGGC
TTCGCTCCCCCAGGCACGTGTACGCTGGTGCGCGTGCCCGACGACTTCTCCTCGCAGTCGGCAAACGTCTGGGGC
GTGCGCCACGTCGCGCTGTGTCCGACGATGCGTGTCCCGGCCGACGTCACCTGGGACCGCGAGGTGGTGTACGAG
GCGGCCTGGAGCCTCTTGTGCGCCGTGCACCAGCATAATGCAGGTGCCCTGGAAGCGGATGCCATTGGAAGCTTG
CTCGTCACGCCGCTGGCTACCGGCGTGGGCCGCGTCAGTGCTGACCGCTGGGCTGGGCAATTCGTCTTGGCGCTC
AAGCATTTCGACGATGCCACCAAGAACCCGGGGAAATGGTCCTGTCTCGATCCATCCGATATTTTGGCATATTCA
TCCGAGGTTGCCAAGACGTGGAAGACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail