Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7067
Gene name
LocationContig_789:80..1236
Strand-
Gene length (bp)1156
Transcript length (bp)1083
Coding sequence length (bp)1083
Protein length (aa) 361

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01398 JAB JAB1/Mov34/MPN/PAD-1 ubiquitin protease 1.7E-29 48 159
PF18323 CSN5_C Cop9 signalosome subunit 5 C-terminal domain 1.4E-16 265 355

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IJM4|CSN5_GIBZE COP9 signalosome complex subunit 5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRI1 PE=3 SV=1 4 357 4.0E-168
sp|Q4WZP2|CSN5_ASPFU COP9 signalosome complex subunit 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=csn5 PE=3 SV=2 1 357 1.0E-139
sp|Q7RXX8|CSN5_NEUCR COP9 signalosome complex subunit 5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-5 PE=1 SV=1 9 354 9.0E-138
sp|Q5BBF1|CSN5_EMENI COP9 signalosome complex subunit 5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rri1 PE=1 SV=2 1 357 2.0E-134
sp|Q54PF3|CSN5_DICDI COP9 signalosome complex subunit 5 OS=Dictyostelium discoideum GN=csn5 PE=1 SV=1 4 358 4.0E-116
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IJM4|CSN5_GIBZE COP9 signalosome complex subunit 5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRI1 PE=3 SV=1 4 357 4.0E-168
sp|Q4WZP2|CSN5_ASPFU COP9 signalosome complex subunit 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=csn5 PE=3 SV=2 1 357 1.0E-139
sp|Q7RXX8|CSN5_NEUCR COP9 signalosome complex subunit 5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=csn-5 PE=1 SV=1 9 354 9.0E-138
sp|Q5BBF1|CSN5_EMENI COP9 signalosome complex subunit 5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rri1 PE=1 SV=2 1 357 2.0E-134
sp|Q54PF3|CSN5_DICDI COP9 signalosome complex subunit 5 OS=Dictyostelium discoideum GN=csn5 PE=1 SV=1 4 358 4.0E-116
sp|Q9XZ58|CSN5_DROME COP9 signalosome complex subunit 5 OS=Drosophila melanogaster GN=CSN5 PE=1 SV=1 2 357 1.0E-111
sp|Q8LAZ7|CSN5B_ARATH COP9 signalosome complex subunit 5b OS=Arabidopsis thaliana GN=CSN5B PE=1 SV=2 3 359 1.0E-107
sp|Q4P804|CSN5_USTMA COP9 signalosome complex subunit 5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRI1 PE=3 SV=1 8 286 1.0E-107
sp|P91001|CSN5_CAEEL COP9 signalosome complex subunit 5 OS=Caenorhabditis elegans GN=csn-5 PE=1 SV=1 8 294 2.0E-107
sp|Q6P635|CSN5_XENTR COP9 signalosome complex subunit 5 OS=Xenopus tropicalis GN=cops5 PE=2 SV=1 3 357 4.0E-105
sp|O35864|CSN5_MOUSE COP9 signalosome complex subunit 5 OS=Mus musculus GN=Cops5 PE=1 SV=3 3 357 5.0E-105
sp|Q92905|CSN5_HUMAN COP9 signalosome complex subunit 5 OS=Homo sapiens GN=COPS5 PE=1 SV=4 3 357 6.0E-105
sp|Q6PC30|CSN5_DANRE COP9 signalosome complex subunit 5 OS=Danio rerio GN=cops5 PE=2 SV=1 3 357 7.0E-105
sp|Q6GLM9|CSN5_XENLA COP9 signalosome complex subunit 5 OS=Xenopus laevis GN=cops5 PE=2 SV=1 3 357 1.0E-104
sp|Q6C703|CSN5_YARLI COP9 signalosome complex subunit 5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRI1 PE=3 SV=1 8 354 1.0E-104
sp|Q9FVU9|CSN5A_ARATH COP9 signalosome complex subunit 5a OS=Arabidopsis thaliana GN=CSN5A PE=1 SV=1 3 359 1.0E-103
sp|P0CQ24|CSN5_CRYNJ COP9 signalosome complex subunit 5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRI1 PE=3 SV=1 4 355 3.0E-95
sp|P0CQ25|CSN5_CRYNB COP9 signalosome complex subunit 5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRI1 PE=3 SV=1 4 355 3.0E-95
sp|Q6BMQ3|CSN5_DEBHA COP9 signalosome complex subunit 5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRI1 PE=3 SV=2 22 264 3.0E-78
sp|O94454|CSN5_SCHPO COP9 signalosome complex subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csn5 PE=1 SV=1 22 282 1.0E-72
sp|Q75E19|CSN5_ASHGO COP9 signalosome complex subunit 5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRI1 PE=3 SV=1 19 244 1.0E-58
sp|Q59PG6|CSN5_CANAL COP9 signalosome complex subunit 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRI1 PE=3 SV=1 35 183 7.0E-55
sp|Q6CRJ8|CSN5_KLULA COP9 signalosome complex subunit 5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRI1 PE=3 SV=1 43 186 2.0E-51
sp|Q6FT36|CSN5_CANGA COP9 signalosome complex subunit 5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRI1 PE=3 SV=1 45 185 9.0E-45
sp|B3LH96|CSN5_YEAS1 COP9 signalosome complex subunit 5 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RRI1 PE=3 SV=2 42 185 9.0E-42
sp|A6ZXB7|CSN5_YEAS7 COP9 signalosome complex subunit 5 OS=Saccharomyces cerevisiae (strain YJM789) GN=RRI1 PE=3 SV=2 42 185 9.0E-42
sp|Q12468|CSN5_YEAST COP9 signalosome complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRI1 PE=1 SV=2 42 185 1.0E-41
sp|Q86IJ1|PSDE_DICDI 26S proteasome non-ATPase regulatory subunit 14 OS=Dictyostelium discoideum GN=psmD14 PE=3 SV=1 45 288 4.0E-40
sp|Q9V3H2|PSDE_DROME 26S proteasome non-ATPase regulatory subunit 14 OS=Drosophila melanogaster GN=Rpn11 PE=1 SV=1 49 265 9.0E-38
sp|P41883|YPT5_CAEEL Uncharacterized protein F37A4.5 OS=Caenorhabditis elegans GN=F37A4.5 PE=3 SV=1 45 296 4.0E-37
sp|O35593|PSDE_MOUSE 26S proteasome non-ATPase regulatory subunit 14 OS=Mus musculus GN=Psmd14 PE=1 SV=2 49 265 2.0E-36
sp|O00487|PSDE_HUMAN 26S proteasome non-ATPase regulatory subunit 14 OS=Homo sapiens GN=PSMD14 PE=1 SV=1 49 265 2.0E-36
sp|O76577|PSDE_CAEEL 26S proteasome non-ATPase regulatory subunit 14 OS=Caenorhabditis elegans GN=rpn-11 PE=1 SV=1 49 265 4.0E-36
sp|Q9LT08|PSDE_ARATH 26S proteasome non-ATPase regulatory subunit 14 homolog OS=Arabidopsis thaliana GN=RPN11 PE=1 SV=1 49 277 8.0E-36
sp|P41878|RPN11_SCHPO 26S proteasome regulatory subunit rpn11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn11 PE=1 SV=2 51 264 5.0E-34
sp|Q750E9|RPN11_ASHGO 26S proteasome regulatory subunit RPN11 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPN11 PE=3 SV=1 49 288 8.0E-34
sp|P43588|RPN11_YEAST Ubiquitin carboxyl-terminal hydrolase RPN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN11 PE=1 SV=1 49 260 7.0E-33
sp|Q6FKS1|RPN11_CANGA 26S proteasome regulatory subunit RPN11 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPN11 PE=3 SV=1 51 290 9.0E-33
sp|Q8SQY3|RPN11_ENCCU 26S proteasome regulatory subunit RPN11 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPN11 PE=1 SV=1 49 308 1.0E-32
sp|B5X8M4|BRCC3_SALSA Lys-63-specific deubiquitinase BRCC36 OS=Salmo salar GN=brcc3 PE=2 SV=1 51 165 1.0E-06
sp|B6MUN4|MYSM1_BRAFL Histone H2A deubiquitinase MYSM1 OS=Branchiostoma floridae GN=MYSM1 PE=3 SV=1 21 171 1.0E-06
sp|Q66GV6|BRCC3_XENLA Lys-63-specific deubiquitinase BRCC36 OS=Xenopus laevis GN=brcc3 PE=2 SV=1 51 165 3.0E-06
sp|Q6NKP9|AMSH2_ARATH AMSH-like ubiquitin thioesterase 2 OS=Arabidopsis thaliana GN=AMSH2 PE=2 SV=1 42 168 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0070122 obsolete isopeptidase activity Yes
GO:0140492 metal-dependent deubiquitinase activity Yes
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0003674 molecular_function No
GO:0008237 metallopeptidase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0101005 deubiquitinase activity No
GO:0008233 peptidase activity No
GO:0140096 catalytic activity, acting on a protein No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7067
MDLARTAWELDNNIELVDPVRDSLYNYNADAHKAATQDRPWSRDPHYFKNIRISAVALIKMTMHARSGGDLEVMG
LMQGYVDDDAFVVTDAFRLPVEGTETRVNAQGEANEYLIEYLDLCRTQGRQENVVGWYHSHPGYGCWLSGIDVET
EQLQQQFQDPFVAVVIDPHRTISAGKVEIGAFRTFPPNYKYGEGDHPRQGASGDVTSAQADRVQGERQAVPLAKA
AEFGAYAYRYYSVQVSHFKSTLDSQLLQQLWHKYWVQTLSQNPLLTNRDYDTKQIVDLSSKTKVATKGLGRGRTP
ALGMNDYRATAAAGDSASGAPTLAPIEMLAQEFSLVAAKERTGLMADEVKAKVFNDLRKQ*
Coding >OphauG2|7067
ATGGATCTTGCTCGCACGGCCTGGGAGCTCGACAACAACATTGAGCTTGTGGATCCCGTGCGCGATTCCCTCTAC
AACTACAATGCCGACGCTCACAAGGCAGCGACTCAAGACAGACCCTGGTCGCGCGACCCGCACTACTTCAAAAAC
ATACGCATCAGCGCCGTGGCCCTCATCAAAATGACGATGCACGCCCGTTCCGGAGGCGACTTGGAAGTCATGGGC
CTGATGCAGGGCTACGTCGACGATGACGCTTTTGTCGTCACTGACGCTTTCCGCCTGCCTGTCGAGGGCACCGAG
ACGCGAGTCAATGCCCAGGGCGAGGCCAACGAATATCTCATCGAGTATCTCGACCTCTGCCGCACTCAGGGCCGC
CAGGAAAACGTAGTGGGCTGGTATCATAGCCATCCCGGCTATGGCTGCTGGCTGAGTGGCATCGACGTAGAGACG
GAGCAGCTACAGCAGCAGTTCCAGGACCCTTTTGTTGCCGTCGTTATTGATCCTCACCGCACCATCAGTGCAGGA
AAAGTCGAAATCGGCGCTTTCCGGACCTTTCCTCCCAATTACAAGTATGGTGAAGGCGACCACCCACGTCAAGGG
GCCAGTGGCGACGTCACCTCGGCCCAAGCCGACCGCGTTCAAGGAGAAAGACAGGCCGTGCCGCTGGCCAAGGCG
GCCGAGTTTGGAGCCTACGCCTACCGCTACTATAGCGTACAAGTATCTCACTTCAAGAGCACCCTCGACTCACAG
CTACTCCAACAACTGTGGCACAAGTACTGGGTCCAGACGCTGAGCCAGAACCCGCTCCTGACAAACCGAGACTAT
GACACGAAGCAGATTGTCGATTTGAGCTCCAAGACAAAAGTAGCGACCAAAGGTTTGGGACGTGGTCGAACACCC
GCTCTTGGGATGAATGACTACCGGGCGACTGCAGCTGCAGGTGATTCTGCATCAGGGGCGCCCACGCTGGCACCG
ATTGAGATGCTGGCACAAGAGTTCAGCCTGGTGGCTGCCAAGGAAAGGACGGGTCTCATGGCTGATGAAGTAAAG
GCCAAGGTGTTTAACGACTTGCGCAAGCAGTAG
Transcript >OphauG2|7067
ATGGATCTTGCTCGCACGGCCTGGGAGCTCGACAACAACATTGAGCTTGTGGATCCCGTGCGCGATTCCCTCTAC
AACTACAATGCCGACGCTCACAAGGCAGCGACTCAAGACAGACCCTGGTCGCGCGACCCGCACTACTTCAAAAAC
ATACGCATCAGCGCCGTGGCCCTCATCAAAATGACGATGCACGCCCGTTCCGGAGGCGACTTGGAAGTCATGGGC
CTGATGCAGGGCTACGTCGACGATGACGCTTTTGTCGTCACTGACGCTTTCCGCCTGCCTGTCGAGGGCACCGAG
ACGCGAGTCAATGCCCAGGGCGAGGCCAACGAATATCTCATCGAGTATCTCGACCTCTGCCGCACTCAGGGCCGC
CAGGAAAACGTAGTGGGCTGGTATCATAGCCATCCCGGCTATGGCTGCTGGCTGAGTGGCATCGACGTAGAGACG
GAGCAGCTACAGCAGCAGTTCCAGGACCCTTTTGTTGCCGTCGTTATTGATCCTCACCGCACCATCAGTGCAGGA
AAAGTCGAAATCGGCGCTTTCCGGACCTTTCCTCCCAATTACAAGTATGGTGAAGGCGACCACCCACGTCAAGGG
GCCAGTGGCGACGTCACCTCGGCCCAAGCCGACCGCGTTCAAGGAGAAAGACAGGCCGTGCCGCTGGCCAAGGCG
GCCGAGTTTGGAGCCTACGCCTACCGCTACTATAGCGTACAAGTATCTCACTTCAAGAGCACCCTCGACTCACAG
CTACTCCAACAACTGTGGCACAAGTACTGGGTCCAGACGCTGAGCCAGAACCCGCTCCTGACAAACCGAGACTAT
GACACGAAGCAGATTGTCGATTTGAGCTCCAAGACAAAAGTAGCGACCAAAGGTTTGGGACGTGGTCGAACACCC
GCTCTTGGGATGAATGACTACCGGGCGACTGCAGCTGCAGGTGATTCTGCATCAGGGGCGCCCACGCTGGCACCG
ATTGAGATGCTGGCACAAGAGTTCAGCCTGGTGGCTGCCAAGGAAAGGACGGGTCTCATGGCTGATGAAGTAAAG
GCCAAGGTGTTTAACGACTTGCGCAAGCAGTAG
Gene >OphauG2|7067
ATGGATCTTGCTCGCACGGCCTGGGGTGCGTTTGTCCTCGCATACTTGGTATAGGGCCCCTCGAATCCATGGTTG
GACTAACGCTTTCCCCCCTCCAGAGCTCGACAACAACATTGAGCTTGTGGATCCCGTGCGCGATTCCCTCTACAA
CTACAATGCCGACGCTCACAAGGCAGCGACTCAAGACAGACCCTGGTCGCGCGACCCGCACTACTTCAAAAACAT
ACGCATCAGCGCCGTGGCCCTCATCAAAATGACGATGCACGCCCGTTCCGGAGGCGACTTGGAAGTCATGGGCCT
GATGCAGGGCTACGTCGACGATGACGCTTTTGTCGTCACTGACGCTTTCCGCCTGCCTGTCGAGGGCACCGAGAC
GCGAGTCAATGCCCAGGGCGAGGCCAACGAATATCTCATCGAGTATCTCGACCTCTGCCGCACTCAGGGCCGCCA
GGAAAACGTAGTGGGCTGGTATCATAGCCATCCCGGCTATGGCTGCTGGCTGAGTGGCATCGACGTAGAGACGGA
GCAGCTACAGCAGCAGTTCCAGGACCCTTTTGTTGCCGTCGTTATTGATCCTCACCGCACCATCAGTGCAGGAAA
AGTCGAAATCGGCGCTTTCCGGACCTTTCCTCCCAATTACAAGTATGGTGAAGGCGACCACCCACGTCAAGGGGC
CAGTGGCGACGTCACCTCGGCCCAAGCCGACCGCGTTCAAGGAGAAAGACAGGCCGTGCCGCTGGCCAAGGCGGC
CGAGTTTGGAGCCTACGCCTACCGCTACTATAGCGTACAAGTATCTCACTTCAAGAGCACCCTCGACTCACAGCT
ACTCCAACAACTGTGGCACAAGTACTGGGTCCAGACGCTGAGCCAGAACCCGCTCCTGACAAACCGAGACTATGA
CACGAAGCAGATTGTCGATTTGAGCTCCAAGACAAAAGTAGCGACCAAAGGTTTGGGACGTGGTCGAACACCCGC
TCTTGGGATGAATGACTACCGGGCGACTGCAGCTGCAGGTGATTCTGCATCAGGGGCGCCCACGCTGGCACCGAT
TGAGATGCTGGCACAAGAGTTCAGCCTGGTGGCTGCCAAGGAAAGGACGGGTCTCATGGCTGATGAAGTAAAGGC
CAAGGTGTTTAACGACTTGCGCAAGCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail