Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7066
Gene name
LocationContig_788:6137..7093
Strand+
Gene length (bp)956
Transcript length (bp)489
Coding sequence length (bp)489
Protein length (aa) 163

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00098 zf-CCHC Zinc knuckle 2.4E-04 68 80
PF00098 zf-CCHC Zinc knuckle 9.6E-06 101 116
PF00098 zf-CCHC Zinc knuckle 1.8E-09 121 137
PF00098 zf-CCHC Zinc knuckle 2.8E-06 145 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 64 161 5.0E-20
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 66 159 1.0E-18
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 65 161 4.0E-17
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 28 161 1.0E-15
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 68 160 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 64 161 5.0E-20
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 66 159 1.0E-18
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 65 161 4.0E-17
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 28 161 1.0E-15
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 68 160 2.0E-15
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 68 160 3.0E-15
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 61 160 5.0E-14
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 48 162 9.0E-14
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 68 159 1.0E-10
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 68 159 1.0E-10
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 68 159 1.0E-10
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 63 159 1.0E-10
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 63 159 1.0E-10
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 63 159 1.0E-10
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 65 160 1.0E-10
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 56 159 2.0E-10
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 56 159 2.0E-10
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 56 159 2.0E-10
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 56 159 3.0E-10
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 56 159 7.0E-10
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 66 160 8.0E-10
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 65 161 2.0E-09
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 56 159 2.0E-09
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 65 161 2.0E-09
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 65 161 2.0E-09
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 100 160 3.0E-09
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 65 161 5.0E-09
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 65 161 7.0E-09
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 65 161 9.0E-09
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 67 147 1.0E-08
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 64 159 3.0E-08
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 68 162 1.0E-07
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 47 159 2.0E-07
sp|P33458|GAG_CAEVC Gag polyprotein OS=Caprine arthritis encephalitis virus (strain Cork) GN=gag PE=3 SV=1 94 135 2.0E-07
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 101 160 4.0E-07
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 103 160 5.0E-07
sp|Q9NUD5|ZCHC3_HUMAN Zinc finger CCHC domain-containing protein 3 OS=Homo sapiens GN=ZCCHC3 PE=1 SV=1 10 161 7.0E-07
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 66 160 1.0E-06
sp|P24107|POL_HV2CA Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag-pol PE=3 SV=3 120 161 1.0E-06
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 101 159 2.0E-06
sp|Q82851|POL_JEMBR Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 96 139 2.0E-06
sp|P03352|GAG_VILV Gag polyprotein OS=Maedi visna virus (strain 1514) GN=gag PE=3 SV=1 98 142 2.0E-06
sp|P23424|GAG_VILV1 Gag polyprotein OS=Maedi visna virus (strain 1514 / clone LV1-1KS1) GN=gag PE=3 SV=1 98 142 2.0E-06
sp|P35955|GAG_VILVK Gag polyprotein OS=Maedi visna virus (strain KV1772) GN=gag PE=3 SV=1 98 142 2.0E-06
sp|P23425|GAG_VILV2 Gag polyprotein OS=Maedi visna virus (strain 1514 / clone LV1-1KS2) GN=gag PE=3 SV=1 98 142 2.0E-06
sp|P04584|POL_HV2RO Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag-pol PE=1 SV=3 119 161 2.0E-06
sp|P19560|POL_BIV29 Gag-Pol polyprotein OS=Bovine immunodeficiency virus (strain R29) GN=gag-pol PE=1 SV=2 87 135 3.0E-06
sp|P19505|POL_SIVSP Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate PBj14/BCL-3) GN=gag-pol PE=1 SV=2 120 160 3.0E-06
sp|Q02836|POL_SIVG1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag-pol PE=3 SV=2 103 145 3.0E-06
sp|P15833|POL_HV2D2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate D205) GN=gag-pol PE=3 SV=3 99 145 3.0E-06
sp|O91080|POL_HV1YF Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF30) GN=gag-pol PE=3 SV=3 120 161 3.0E-06
sp|A1L2T6|ZCHC7_XENLA Zinc finger CCHC domain-containing protein 7 OS=Xenopus laevis GN=zcchc7 PE=2 SV=2 64 160 3.0E-06
sp|Q9FYB7|RSZ32_ARATH Serine/arginine-rich splicing factor RS2Z32 OS=Arabidopsis thaliana GN=RS2Z32 PE=1 SV=1 87 135 7.0E-06
sp|P24106|GAG_HV2CA Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag PE=3 SV=3 120 161 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7066
MPAAPLAIRLVIARPAALLNATTVAARATSVENAPSPSKTTSRVTNVDSQDISRVIVLPAVVPVVLECGEMGHIA
RSCPKSSFGGTSYGGGSFGPGGGAGKTCYSCGGYGHMSRECVNGMKCYNCGETGHFSRECPKESAGGERICYKCQ
QPGHVQAQCPNN*
Coding >OphauG2|7066
ATGCCTGCGGCTCCACTGGCCATCAGGCTCGTGATTGCCCGTCCCGCGGCCCTGCTAAATGCTACAACTGTGGCG
GCGAGGGCCACATCAGTCGAGAATGCCCCGAGCCCCTCAAAGACAACAAGTCGTGTTACAAATGTGGACAGCCAG
GACATATCTCGCGTGATTGTCCTACCAGCGGTGGTGCCGGTGGTGCTGGAGTGCGGAGAAATGGGACATATTGCC
CGCAGCTGTCCCAAATCTTCGTTTGGCGGTACGTCGTATGGCGGTGGCAGCTTTGGACCCGGTGGTGGCGCTGGC
AAGACTTGCTATTCTTGCGGAGGATACGGCCACATGTCGCGTGAGTGCGTCAATGGCATGAAGTGCTATAATTGT
GGTGAGACGGGCCACTTCTCCAGAGAGTGCCCTAAGGAATCGGCTGGAGGCGAAAGGATCTGTTATAAATGCCAA
CAACCTGGACACGTGCAGGCTCAGTGCCCCAACAACTAA
Transcript >OphauG2|7066
ATGCCTGCGGCTCCACTGGCCATCAGGCTCGTGATTGCCCGTCCCGCGGCCCTGCTAAATGCTACAACTGTGGCG
GCGAGGGCCACATCAGTCGAGAATGCCCCGAGCCCCTCAAAGACAACAAGTCGTGTTACAAATGTGGACAGCCAG
GACATATCTCGCGTGATTGTCCTACCAGCGGTGGTGCCGGTGGTGCTGGAGTGCGGAGAAATGGGACATATTGCC
CGCAGCTGTCCCAAATCTTCGTTTGGCGGTACGTCGTATGGCGGTGGCAGCTTTGGACCCGGTGGTGGCGCTGGC
AAGACTTGCTATTCTTGCGGAGGATACGGCCACATGTCGCGTGAGTGCGTCAATGGCATGAAGTGCTATAATTGT
GGTGAGACGGGCCACTTCTCCAGAGAGTGCCCTAAGGAATCGGCTGGAGGCGAAAGGATCTGTTATAAATGCCAA
CAACCTGGACACGTGCAGGCTCAGTGCCCCAACAACTAA
Gene >OphauG2|7066
ATGCCTGTGAGTACCCAGTTGCATCTTTTCTGTCATGGCTCTACGCCTTTTCTCTCAGCCTCTCTAACAAACTTT
GCGCAGGCGGCTCCACTGGCCATCAGGTACGGGAAACGATACCGTGTGCTAGAACCCTAGCCTGACAACTGCTGC
TCTAGGCTCGTGATTGCCCGTCCCGCGGCCCTGCTAAATGGTGAGTTTGCATGAGCTCTGTAATATGTCCTCGAA
CGTTTGGAATTGACGGATTGATTTAGCTACAACTGTGGCGGTATGCCCCAACACTTCACTGCCTCGTACTTGCAG
TCTTGCTAATCGCAGATGCATTGCTCCAGGCGAGGGCCACATCAGTAAGTACTCCATTCTTAGACTATGAAATGG
CTTTTGGCTCACAAAACTTCTTCAAGGTCGAGAATGCCCCGAGCCCCTCAAAGACAACAAGTCGTGTTACAAATG
TGGACAGCCAGGACATATCTCGCGTGATTGTCCTACCAGCGGTGGTGCCGGTGGTGCTGGAGGTAATGGGCCATC
AACTGAATGTTACAAGGTAAATCTAGGTTCTTCACTGCACTGTGCTACCACCAGCACCAGCGTCAGCGTCAGCTA
ACGCGGAAAACCAGTGCGGAGAAATGGGACATATTGCCCGCAGCTGTCCCAAATCTTCGTTTGGCGGTACGTCGT
ATGGCGGTGGCAGCTTTGGACCCGGTGGTGGCGCTGGCAAGACTTGCTATTCTTGCGGAGGATACGGCCACATGT
CGCGTAAGGAAACACCTTTTTGCCCCAGCTTTCTTTGAGATGCTGACCGTGATACAGGTGAGTGCGTCAATGGCA
TGAAGTGCTATAATTGTGGTGAGACGGGCCACTTCTCCAGAGAGTGCCCTAAGGAATCGGCTGGAGGCGAAAGGA
TCTGTTATAAATGCCAACAACCTGGACACGTGCAGGCTCAGTGCCCCAACAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail