Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7064
Gene name
LocationContig_788:1026..2461
Strand+
Gene length (bp)1435
Transcript length (bp)1137
Coding sequence length (bp)1137
Protein length (aa) 379

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y) 1.8E-58 34 326

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36421|SYYC_YEAST Tyrosine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TYS1 PE=1 SV=3 2 375 4.0E-134
sp|Q6TGS6|SYYC_DANRE Tyrosine--tRNA ligase, cytoplasmic OS=Danio rerio GN=yars PE=2 SV=2 4 376 2.0E-119
sp|O14055|SYYC_SCHPO Tyrosine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tys1 PE=3 SV=1 3 350 2.0E-117
sp|Q6DIJ1|SYYC_XENTR Tyrosine--tRNA ligase, cytoplasmic OS=Xenopus tropicalis GN=yars PE=2 SV=1 3 354 2.0E-117
sp|Q7ZX51|SYYC_XENLA Tyrosine--tRNA ligase, cytoplasmic OS=Xenopus laevis GN=yars PE=2 SV=1 12 354 1.0E-116
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36421|SYYC_YEAST Tyrosine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TYS1 PE=1 SV=3 2 375 4.0E-134
sp|Q6TGS6|SYYC_DANRE Tyrosine--tRNA ligase, cytoplasmic OS=Danio rerio GN=yars PE=2 SV=2 4 376 2.0E-119
sp|O14055|SYYC_SCHPO Tyrosine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tys1 PE=3 SV=1 3 350 2.0E-117
sp|Q6DIJ1|SYYC_XENTR Tyrosine--tRNA ligase, cytoplasmic OS=Xenopus tropicalis GN=yars PE=2 SV=1 3 354 2.0E-117
sp|Q7ZX51|SYYC_XENLA Tyrosine--tRNA ligase, cytoplasmic OS=Xenopus laevis GN=yars PE=2 SV=1 12 354 1.0E-116
sp|Q5ZJ08|SYYC_CHICK Tyrosine--tRNA ligase, cytoplasmic OS=Gallus gallus GN=YARS PE=2 SV=1 2 362 3.0E-116
sp|Q29465|SYYC_BOVIN Tyrosine--tRNA ligase, cytoplasmic OS=Bos taurus GN=YARS PE=2 SV=4 3 354 5.0E-112
sp|Q4KM49|SYYC_RAT Tyrosine--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Yars PE=2 SV=3 3 354 6.0E-112
sp|P54577|SYYC_HUMAN Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=YARS PE=1 SV=4 3 354 4.0E-111
sp|Q91WQ3|SYYC_MOUSE Tyrosine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Yars PE=1 SV=3 3 354 7.0E-111
sp|Q5R8T5|SYYC_PONAB Tyrosine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=YARS PE=2 SV=3 3 354 2.0E-110
sp|B7XHC1|SYYC_ENTBH Probable tyrosine--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_24879 PE=3 SV=1 8 329 4.0E-106
sp|Q8SRV7|SYYC_ENCCU Probable tyrosine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU05_1120i PE=3 SV=1 4 334 5.0E-96
sp|C4V6W1|SYYC_NOSCE Probable tyrosine--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_100158 PE=3 SV=1 4 329 7.0E-93
sp|Q5V4J1|SYY_HALMA Tyrosine--tRNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=tyrS PE=3 SV=1 4 348 6.0E-73
sp|Q3IQU8|SYY_NATPD Tyrosine--tRNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=tyrS PE=3 SV=1 4 330 5.0E-70
sp|O29482|SYY_ARCFU Tyrosine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tyrS PE=1 SV=1 7 336 1.0E-54
sp|Q8PVK0|SYY_METMA Tyrosine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=tyrS PE=3 SV=1 8 333 3.0E-52
sp|Q8TSI1|SYY_METAC Tyrosine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tyrS PE=3 SV=1 8 333 2.0E-50
sp|Q46BQ5|SYY_METBF Tyrosine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=tyrS PE=3 SV=1 8 333 2.0E-50
sp|Q8TXZ2|SYY_METKA Tyrosine--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=tyrS PE=3 SV=1 8 335 1.0E-46
sp|A3CYG9|SYY_METMJ Tyrosine--tRNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=tyrS PE=3 SV=1 12 330 1.0E-46
sp|Q2FNA1|SYY_METHJ Tyrosine--tRNA ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=tyrS PE=3 SV=1 11 334 5.0E-45
sp|Q12W06|SYY_METBU Tyrosine--tRNA ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=tyrS PE=3 SV=1 8 334 4.0E-44
sp|A2SU89|SYY_METLZ Tyrosine--tRNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=tyrS PE=3 SV=1 12 337 2.0E-43
sp|Q57834|SYY_METJA Tyrosine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=tyrS PE=1 SV=1 8 331 3.0E-41
sp|O27795|SYY_METTH Tyrosine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=tyrS PE=3 SV=1 8 335 2.0E-40
sp|A5UKJ0|SYY_METS3 Tyrosine--tRNA ligase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=tyrS PE=3 SV=1 4 334 1.0E-37
sp|Q9YA64|SYY_AERPE Tyrosine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=tyrS PE=1 SV=1 1 332 1.0E-37
sp|C3NMQ6|SYY_SULIN Tyrosine--tRNA ligase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=tyrS PE=3 SV=1 4 345 1.0E-36
sp|C3N8R2|SYY_SULIY Tyrosine--tRNA ligase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=tyrS PE=3 SV=1 4 345 2.0E-36
sp|C3MJP1|SYY_SULIL Tyrosine--tRNA ligase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=tyrS PE=3 SV=1 4 345 2.0E-36
sp|C3N048|SYY_SULIA Tyrosine--tRNA ligase OS=Sulfolobus islandicus (strain M.16.27) GN=tyrS PE=3 SV=1 4 345 2.0E-36
sp|C3MYZ9|SYY_SULIM Tyrosine--tRNA ligase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=tyrS PE=3 SV=1 4 345 4.0E-36
sp|C4KJ87|SYY_SULIK Tyrosine--tRNA ligase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=tyrS PE=3 SV=1 4 345 4.0E-36
sp|Q6M0K7|SYY_METMP Tyrosine--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=tyrS PE=3 SV=1 16 329 7.0E-36
sp|Q96YV3|SYY_SULTO Tyrosine--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=tyrS PE=3 SV=3 3 339 4.0E-35
sp|B9LTA6|SYY_HALLT Tyrosine--tRNA ligase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=tyrS PE=3 SV=1 13 328 3.0E-34
sp|P95982|SYY_SULSO Tyrosine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=tyrS PE=3 SV=1 4 345 1.0E-33
sp|Q2NHE1|SYY_METST Tyrosine--tRNA ligase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=tyrS PE=3 SV=1 13 328 2.0E-33
sp|A6URQ1|SYY_METVS Tyrosine--tRNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=tyrS PE=3 SV=1 4 334 3.0E-33
sp|Q4JCH6|SYY_SULAC Tyrosine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=tyrS PE=3 SV=1 8 342 4.0E-33
sp|B0R7E0|SYY_HALS3 Tyrosine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=tyrS PE=3 SV=1 13 328 2.0E-30
sp|Q9HN62|SYY_HALSA Tyrosine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tyrS PE=3 SV=1 13 328 2.0E-30
sp|Q8S9J2|SYYC1_ARATH Tyrosine--tRNA ligase 1, cytoplasmic OS=Arabidopsis thaliana GN=At2g33840 PE=2 SV=1 19 335 4.0E-27
sp|F4HWL4|SYYC2_ARATH Tyrosine--tRNA ligase 2, cytoplasmic OS=Arabidopsis thaliana GN=At1g28350 PE=1 SV=1 36 336 8.0E-27
sp|F4HWL4|SYYC2_ARATH Tyrosine--tRNA ligase 2, cytoplasmic OS=Arabidopsis thaliana GN=At1g28350 PE=1 SV=1 19 337 2.0E-26
sp|Q8ZW77|SYY2_PYRAE Tyrosine--tRNA ligase 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=tyrS2 PE=3 SV=1 49 330 5.0E-26
sp|A3MXW0|SYY_PYRCJ Tyrosine--tRNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=tyrS PE=3 SV=1 8 335 1.0E-25
sp|O58739|SYY_PYRHO Tyrosine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tyrS PE=1 SV=1 19 338 4.0E-25
sp|Q6L2J1|SYY_PICTO Tyrosine--tRNA ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=tyrS PE=3 SV=1 35 329 5.0E-25
sp|Q8U2H3|SYY_PYRFU Tyrosine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tyrS PE=3 SV=1 8 338 2.0E-24
sp|Q9V027|SYY_PYRAB Tyrosine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tyrS PE=3 SV=1 19 338 2.0E-24
sp|A1RSH9|SYY_PYRIL Tyrosine--tRNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=tyrS PE=3 SV=1 8 335 7.0E-23
sp|Q9HKT3|SYY_THEAC Tyrosine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=tyrS PE=3 SV=1 13 335 8.0E-23
sp|Q8ZYT7|SYY1_PYRAE Tyrosine--tRNA ligase 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=tyrS1 PE=3 SV=1 19 335 3.0E-22
sp|B6YWK6|SYY_THEON Tyrosine--tRNA ligase OS=Thermococcus onnurineus (strain NA1) GN=tyrS PE=3 SV=1 19 338 5.0E-22
sp|A4WN67|SYY_PYRAR Tyrosine--tRNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=tyrS PE=3 SV=1 9 335 1.0E-21
sp|C6A0Z6|SYY_THESM Tyrosine--tRNA ligase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=tyrS PE=3 SV=1 19 338 2.0E-21
sp|Q5JF63|SYY_THEKO Tyrosine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tyrS PE=3 SV=1 19 338 3.0E-21
sp|C5A5R0|SYY_THEGJ Tyrosine--tRNA ligase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=tyrS PE=3 SV=1 19 338 1.0E-20
sp|Q74MD3|SYY_NANEQ Tyrosine--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=tyrS PE=3 SV=1 8 337 2.0E-19
sp|Q979Z1|SYY_THEVO Tyrosine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=tyrS PE=3 SV=1 16 331 2.0E-16
sp|Q5UPJ7|SYY_MIMIV Tyrosine--tRNA ligase OS=Acanthamoeba polyphaga mimivirus GN=YARS PE=1 SV=1 26 352 6.0E-14
sp|Q5SIH0|SYY_THET8 Tyrosine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tyrS PE=3 SV=1 5 247 2.0E-08
sp|B6YUH1|SYW_THEON Tryptophan--tRNA ligase OS=Thermococcus onnurineus (strain NA1) GN=trpS PE=3 SV=1 33 247 2.0E-08
sp|P83453|SYY_THET2 Tyrosine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tyrS PE=1 SV=1 5 247 2.0E-08
sp|Q7TV34|SYW_PROMM Tryptophan--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=trpS PE=3 SV=1 34 254 9.0E-08
sp|Q9CMQ8|SYY_PASMU Tyrosine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=tyrS PE=3 SV=1 10 245 1.0E-07
sp|C6A032|SYW_THESM Tryptophan--tRNA ligase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=trpS PE=3 SV=1 33 247 2.0E-07
sp|Q7TTU9|SYW_SYNPX Tryptophan--tRNA ligase OS=Synechococcus sp. (strain WH8102) GN=trpS PE=3 SV=1 36 253 3.0E-07
sp|Q65T71|SYY_MANSM Tyrosine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=tyrS PE=3 SV=1 10 245 5.0E-07
sp|P43836|SYY_HAEIN Tyrosine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tyrS PE=3 SV=1 10 245 6.0E-07
sp|Q4QL45|SYY_HAEI8 Tyrosine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=tyrS PE=3 SV=1 10 245 6.0E-07
sp|Q6FG10|SYY_ACIAD Tyrosine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=tyrS PE=3 SV=1 1 245 7.0E-07
sp|Q5X7H7|SYY_LEGPA Tyrosine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=tyrS PE=3 SV=1 19 245 1.0E-06
sp|Q5JEP3|SYW_THEKO Tryptophan--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=trpS PE=3 SV=1 33 247 1.0E-06
sp|Q3K5W9|SYY_PSEPF Tyrosine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=tyrS PE=3 SV=1 5 245 1.0E-06
sp|Q4JBG7|SYW_SULAC Tryptophan--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=trpS PE=3 SV=1 32 247 2.0E-06
sp|Q88QQ2|SYY_PSEPK Tyrosine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=tyrS PE=3 SV=1 5 245 2.0E-06
sp|Q5ZY07|SYY_LEGPH Tyrosine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=tyrS PE=3 SV=2 19 245 2.0E-06
sp|Q4K517|SYY_PSEF5 Tyrosine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=tyrS PE=3 SV=1 5 245 2.0E-06
sp|Q7VZ05|SYW_BORPE Tryptophan--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=trpS PE=3 SV=1 35 226 2.0E-06
sp|Q7W5T6|SYW_BORPA Tryptophan--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=trpS PE=3 SV=1 35 226 3.0E-06
sp|Q7WGI7|SYW_BORBR Tryptophan--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=trpS PE=3 SV=1 35 226 3.0E-06
sp|Q9I5Q3|SYY2_PSEAE Tyrosine--tRNA ligase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tyrS2 PE=3 SV=1 5 245 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0000166 nucleotide binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0006520 cellular amino acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006399 tRNA metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016874 ligase activity No
GO:0043038 amino acid activation No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043039 tRNA aminoacylation No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7064
MAALSPAERLALINHNLAEILNPEILEKIVHEGRNPKVYWGTATTGRPHCGYFVPAIKIAQLLAAGCDVTVLLAD
IHGFLDNLKAPLELVAQRVEYYRLTIQAILEAVGVSTERLRFVQGSDYQKTADYVMDVYKLSSLVSEHDAKRAGA
EVVKQSDNAPLSGMLYPILQVLDEQYLDVDAQFGGLDQRKLFIAAKEWLPKIGYRERAHIMNPMVPGLHGGKMSS
SDQDSKIDLLDDPEVVTKKIKKAVAAPQVVEDNGVLAFVEFVLLPAAALRGNPGFTVSRERDGLEPLVYTDIKAM
QNDYKNDVLNPQLLKPAVAQGLNELLAPINKAFQASKEWQEIALKAYPPPPKKEKKEKKVKDKGSRHPGKQNTTQ
DSK*
Coding >OphauG2|7064
ATGGCCGCCCTGTCGCCAGCCGAGAGACTGGCCCTCATCAACCACAACCTGGCCGAGATCCTCAACCCCGAAATC
CTGGAAAAAATCGTCCACGAGGGCCGCAATCCCAAGGTCTACTGGGGAACCGCCACCACTGGCCGCCCTCACTGT
GGCTACTTTGTTCCAGCCATCAAGATTGCACAGCTCCTGGCCGCCGGGTGCGACGTAACCGTGCTGCTTGCCGAC
ATCCATGGCTTTCTCGACAACCTCAAGGCCCCTCTGGAGCTTGTTGCCCAGCGCGTTGAGTACTATCGTCTCACC
ATCCAAGCCATACTCGAGGCCGTGGGCGTTTCAACCGAGAGACTACGCTTTGTCCAGGGCAGCGACTACCAAAAG
ACTGCCGACTATGTCATGGATGTCTATAAGCTGTCATCTTTGGTCTCGGAGCACGACGCTAAGCGGGCCGGCGCC
GAGGTGGTCAAACAATCCGACAATGCGCCGCTTAGTGGCATGCTCTATCCCATTTTGCAGGTCCTGGACGAGCAG
TACCTGGATGTCGATGCTCAGTTCGGAGGCCTCGATCAGCGCAAGCTTTTCATAGCTGCCAAGGAGTGGCTGCCA
AAGATTGGATACCGAGAGCGAGCCCACATTATGAACCCAATGGTGCCAGGCTTACACGGCGGAAAGATGAGCTCG
AGTGATCAAGACAGCAAGATCGACCTTTTGGACGACCCCGAAGTCGTGACCAAGAAAATTAAAAAGGCAGTTGCA
GCTCCCCAGGTTGTTGAAGACAATGGGGTTCTGGCCTTTGTCGAGTTTGTTTTGCTCCCGGCTGCAGCGCTTCGA
GGAAATCCGGGCTTCACCGTTAGCCGAGAACGAGACGGCCTGGAACCTCTTGTCTACACAGACATCAAGGCGATG
CAAAACGACTATAAGAATGACGTGCTGAACCCTCAACTTCTCAAGCCCGCGGTGGCTCAAGGTCTCAATGAACTA
CTTGCCCCAATCAACAAGGCATTTCAAGCCTCCAAAGAGTGGCAAGAGATAGCCCTCAAGGCCTACCCGCCTCCG
CCCAAAAAAGAAAAGAAGGAAAAAAAGGTCAAGGACAAGGGCTCGCGCCATCCGGGAAAGCAAAACACAACCCAG
GATTCCAAGTAA
Transcript >OphauG2|7064
ATGGCCGCCCTGTCGCCAGCCGAGAGACTGGCCCTCATCAACCACAACCTGGCCGAGATCCTCAACCCCGAAATC
CTGGAAAAAATCGTCCACGAGGGCCGCAATCCCAAGGTCTACTGGGGAACCGCCACCACTGGCCGCCCTCACTGT
GGCTACTTTGTTCCAGCCATCAAGATTGCACAGCTCCTGGCCGCCGGGTGCGACGTAACCGTGCTGCTTGCCGAC
ATCCATGGCTTTCTCGACAACCTCAAGGCCCCTCTGGAGCTTGTTGCCCAGCGCGTTGAGTACTATCGTCTCACC
ATCCAAGCCATACTCGAGGCCGTGGGCGTTTCAACCGAGAGACTACGCTTTGTCCAGGGCAGCGACTACCAAAAG
ACTGCCGACTATGTCATGGATGTCTATAAGCTGTCATCTTTGGTCTCGGAGCACGACGCTAAGCGGGCCGGCGCC
GAGGTGGTCAAACAATCCGACAATGCGCCGCTTAGTGGCATGCTCTATCCCATTTTGCAGGTCCTGGACGAGCAG
TACCTGGATGTCGATGCTCAGTTCGGAGGCCTCGATCAGCGCAAGCTTTTCATAGCTGCCAAGGAGTGGCTGCCA
AAGATTGGATACCGAGAGCGAGCCCACATTATGAACCCAATGGTGCCAGGCTTACACGGCGGAAAGATGAGCTCG
AGTGATCAAGACAGCAAGATCGACCTTTTGGACGACCCCGAAGTCGTGACCAAGAAAATTAAAAAGGCAGTTGCA
GCTCCCCAGGTTGTTGAAGACAATGGGGTTCTGGCCTTTGTCGAGTTTGTTTTGCTCCCGGCTGCAGCGCTTCGA
GGAAATCCGGGCTTCACCGTTAGCCGAGAACGAGACGGCCTGGAACCTCTTGTCTACACAGACATCAAGGCGATG
CAAAACGACTATAAGAATGACGTGCTGAACCCTCAACTTCTCAAGCCCGCGGTGGCTCAAGGTCTCAATGAACTA
CTTGCCCCAATCAACAAGGCATTTCAAGCCTCCAAAGAGTGGCAAGAGATAGCCCTCAAGGCCTACCCGCCTCCG
CCCAAAAAAGAAAAGAAGGAAAAAAAGGTCAAGGACAAGGGCTCGCGCCATCCGGGAAAGCAAAACACAACCCAG
GATTCCAAGTAA
Gene >OphauG2|7064
ATGGCCGCCCTGTCGCCAGCCGAGAGACTGGCCCTCATCAACCACAACCTGGCCGAGATCCTCAACCCCGAAATC
CTGGAAAAAATCGTCCACGAGGGCCGCAATCCCAAGGTCTACTGGGGTATGCCTTTCTCCTCCTCTCCCCCCACG
CCAGCTCACCCTTCTCCGTTTAGGAACCGCCACCACTGGCCGCCCTCACTGTGGCTACTTTGTTCCAGCCATCAA
GATTGCACAGCTCCTGGCCGCCGGGTGCGACGTAACCGTGCTGCTTGCCGACATCCATGGCTTTCTCGACAACCT
CAAGGCCCCTCTGGAGCTTGTTGCCCAGCGCGTTGAGTACTATCGTCTCACCATCCAAGCCATACTCGAGGCCGT
GGGCGTTTCAACCGAGAGACTACGCTTTGTCCAGGGCAGCGACTACCAAAAGACTGCCGACTATGTCATGGATGT
CTATAAGCTGTCATCTTTGGTCTCGGAGCACGACGCTAAGCGGGCCGGCGCCGAGGTGGTCAAACAATCCGACAA
TGCGCCGCTTAGTGGCATGCTCTATCCCATTTTGCAGGTCCTGGACGAGCAGTACCTGGATGTCGATGCTCAGTT
CGGAGGTTGGCTTTGGCTCCCCACTCACCCATAGCACAAAGCTAATATGCCCAGGCCTCGATCAGCGCAAGCTTT
TCATAGCTGCCAAGGAGTGGCTGCCAAAGATTGGATACCGAGAGGTAGCTTCAAGCTTCCATCCTCTTTCGCCCC
AAAACACCAAATACTTACTTCTCACAGCGAGCCCACATTATGAACCCAATGGTGCCAGGCTTACACGGCGGAAAG
ATGAGCTCGAGTGATCAAGGTAAAAATGCCTGACGAGGCCCTTCCTCTGGCTTGACATTTTGTCAGTTGCTCACC
ACCACCTTTAGACAGCAAGATCGACCTTTTGGACGACCCCGAAGTCGTGACCAAGAAAATTAAAAAGGCAGTTGC
AGCTCCCCAGGTTGTTGAAGACAATGGGGTTCTGGCCTTTGTCGAGTTTGTTTTGCTCCCGGCTGCAGCGCTTCG
AGGAAATCCGGGCTTCACCGTTAGCCGAGAACGAGACGGCCTGGAACCTCTTGTCTACACAGACATCAAGGCGAT
GCAAAACGACTATAAGAATGACGTGGTAAGCTGGTCAACCTGTGATTCTAAAACACGCCCACCTGTAGTTGTGCG
GAACTAAGCATCAATCTTGCAGCTGAACCCTCAACTTCTCAAGCCCGCGGTGGCTCAAGGTCTCAATGAACTACT
TGCCCCAATCAACAAGGCATTTCAAGCCTCCAAAGAGTGGCAAGAGATAGCCCTCAAGGCCTACCCGCCTCCGCC
CAAAAAAGAAAAGAAGGAAAAAAAGGTCAAGGACAAGGGCTCGCGCCATCCGGGAAAGCAAAACACAACCCAGGA
TTCCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail