Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7059
Gene name
LocationContig_787:1444..2125
Strand+
Gene length (bp)681
Transcript length (bp)681
Coding sequence length (bp)681
Protein length (aa) 227

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01966 HD HD domain 9.8E-07 31 123
PF08668 HDOD HDOD domain 2.0E-05 31 121

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5UQN4|YL432_MIMIV Uncharacterized protein L432 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L432 PE=4 SV=1 20 205 1.0E-17

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7834
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7059 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3139

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7059
MAPAAVADYIQSLLQASHHTPYIGEPISQLQHSLQCAALAAAASPPVDEATQIAALLHDIGQYAPASHLARFTGP
KAVAIANLGNRDSGESVGRVGHETLGARLLQALGFSEKVVRLVESHVAAKRYLCSVDGGYRALLSEASRASLEYQ
GGDMTADERRDFAARRWSEDMCRLRRWDDEAKVQGLYAGTAEEWRGAVLSHLVASRPMQPSMQSSMEPSMEPSID
E*
Coding >OphauG2|7059
ATGGCGCCAGCCGCAGTGGCCGACTATATCCAATCCCTTCTCCAAGCCTCCCACCACACGCCATACATTGGCGAG
CCCATTTCCCAGCTCCAGCACTCGCTGCAATGTGCCGCCCTGGCCGCCGCAGCCTCTCCGCCGGTTGACGAGGCA
ACGCAAATCGCGGCCCTTCTTCACGACATTGGCCAATACGCCCCGGCCAGCCATCTGGCTCGCTTCACTGGGCCC
AAGGCCGTGGCCATCGCCAACCTGGGCAATCGAGACAGCGGCGAGAGCGTCGGACGCGTGGGCCATGAGACGCTG
GGGGCGCGGCTGCTGCAGGCTCTGGGCTTCTCTGAAAAGGTGGTGCGGCTGGTCGAGTCGCACGTGGCAGCCAAG
CGCTATCTGTGCAGCGTCGACGGCGGCTACCGAGCCTTGCTGTCCGAGGCGAGCAGGGCCAGTCTCGAGTACCAG
GGCGGCGACATGACAGCCGACGAGAGGCGCGACTTTGCCGCCCGTCGGTGGAGCGAGGACATGTGTCGTCTGCGG
CGGTGGGACGACGAGGCAAAGGTCCAGGGCCTGTATGCGGGCACGGCCGAGGAGTGGAGAGGCGCGGTGCTGAGC
CACCTGGTTGCCAGCAGGCCGATGCAGCCGTCCATGCAGTCGTCCATGGAGCCGTCCATGGAGCCGTCCATCGAC
GAGTAG
Transcript >OphauG2|7059
ATGGCGCCAGCCGCAGTGGCCGACTATATCCAATCCCTTCTCCAAGCCTCCCACCACACGCCATACATTGGCGAG
CCCATTTCCCAGCTCCAGCACTCGCTGCAATGTGCCGCCCTGGCCGCCGCAGCCTCTCCGCCGGTTGACGAGGCA
ACGCAAATCGCGGCCCTTCTTCACGACATTGGCCAATACGCCCCGGCCAGCCATCTGGCTCGCTTCACTGGGCCC
AAGGCCGTGGCCATCGCCAACCTGGGCAATCGAGACAGCGGCGAGAGCGTCGGACGCGTGGGCCATGAGACGCTG
GGGGCGCGGCTGCTGCAGGCTCTGGGCTTCTCTGAAAAGGTGGTGCGGCTGGTCGAGTCGCACGTGGCAGCCAAG
CGCTATCTGTGCAGCGTCGACGGCGGCTACCGAGCCTTGCTGTCCGAGGCGAGCAGGGCCAGTCTCGAGTACCAG
GGCGGCGACATGACAGCCGACGAGAGGCGCGACTTTGCCGCCCGTCGGTGGAGCGAGGACATGTGTCGTCTGCGG
CGGTGGGACGACGAGGCAAAGGTCCAGGGCCTGTATGCGGGCACGGCCGAGGAGTGGAGAGGCGCGGTGCTGAGC
CACCTGGTTGCCAGCAGGCCGATGCAGCCGTCCATGCAGTCGTCCATGGAGCCGTCCATGGAGCCGTCCATCGAC
GAGTAG
Gene >OphauG2|7059
ATGGCGCCAGCCGCAGTGGCCGACTATATCCAATCCCTTCTCCAAGCCTCCCACCACACGCCATACATTGGCGAG
CCCATTTCCCAGCTCCAGCACTCGCTGCAATGTGCCGCCCTGGCCGCCGCAGCCTCTCCGCCGGTTGACGAGGCA
ACGCAAATCGCGGCCCTTCTTCACGACATTGGCCAATACGCCCCGGCCAGCCATCTGGCTCGCTTCACTGGGCCC
AAGGCCGTGGCCATCGCCAACCTGGGCAATCGAGACAGCGGCGAGAGCGTCGGACGCGTGGGCCATGAGACGCTG
GGGGCGCGGCTGCTGCAGGCTCTGGGCTTCTCTGAAAAGGTGGTGCGGCTGGTCGAGTCGCACGTGGCAGCCAAG
CGCTATCTGTGCAGCGTCGACGGCGGCTACCGAGCCTTGCTGTCCGAGGCGAGCAGGGCCAGTCTCGAGTACCAG
GGCGGCGACATGACAGCCGACGAGAGGCGCGACTTTGCCGCCCGTCGGTGGAGCGAGGACATGTGTCGTCTGCGG
CGGTGGGACGACGAGGCAAAGGTCCAGGGCCTGTATGCGGGCACGGCCGAGGAGTGGAGAGGCGCGGTGCTGAGC
CACCTGGTTGCCAGCAGGCCGATGCAGCCGTCCATGCAGTCGTCCATGGAGCCGTCCATGGAGCCGTCCATCGAC
GAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail