Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7051
Gene name
LocationContig_784:5921..6996
Strand+
Gene length (bp)1075
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 1.2E-61 91 306
PF20434 BD-FAE BD-FAE 5.4E-19 88 186
PF00135 COesterase Carboxylesterase family 1.8E-06 72 131

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US38|YFZ3_SCHPO AB hydrolase superfamily protein C1039.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.03 PE=3 SV=1 4 316 3.0E-79
sp|P9WK87|NLHH_MYCTU Carboxylesterase NlhH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nlhH PE=1 SV=1 36 295 7.0E-33
sp|P9WK86|NLHH_MYCTO Carboxylesterase NlhH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nlhH PE=3 SV=1 36 295 7.0E-33
sp|Q5UQ83|YR526_MIMIV Putative alpha/beta hydrolase R526 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R526 PE=1 SV=1 89 309 1.0E-28
sp|P24484|LIP2_MORS1 Lipase 2 OS=Moraxella sp. (strain TA144) GN=lip2 PE=1 SV=1 72 329 4.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US38|YFZ3_SCHPO AB hydrolase superfamily protein C1039.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.03 PE=3 SV=1 4 316 3.0E-79
sp|P9WK87|NLHH_MYCTU Carboxylesterase NlhH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nlhH PE=1 SV=1 36 295 7.0E-33
sp|P9WK86|NLHH_MYCTO Carboxylesterase NlhH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nlhH PE=3 SV=1 36 295 7.0E-33
sp|Q5UQ83|YR526_MIMIV Putative alpha/beta hydrolase R526 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R526 PE=1 SV=1 89 309 1.0E-28
sp|P24484|LIP2_MORS1 Lipase 2 OS=Moraxella sp. (strain TA144) GN=lip2 PE=1 SV=1 72 329 4.0E-27
sp|Q9HDX3|YKN2_SCHPO AB hydrolase superfamily protein B1A11.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A11.02 PE=3 SV=1 59 305 1.0E-22
sp|Q9LFR7|CXE17_ARATH Probable carboxylesterase 17 OS=Arabidopsis thaliana GN=CXE17 PE=2 SV=1 84 310 9.0E-19
sp|B4TMG8|AES_SALSV Acetyl esterase OS=Salmonella schwarzengrund (strain CVM19633) GN=aes PE=3 SV=1 67 317 1.0E-18
sp|O64640|CXE8_ARATH Probable carboxylesterase 8 OS=Arabidopsis thaliana GN=CXE8 PE=2 SV=1 64 303 2.0E-18
sp|B5EXN3|AES_SALA4 Acetyl esterase OS=Salmonella agona (strain SL483) GN=aes PE=3 SV=1 67 317 4.0E-18
sp|A9MW81|AES_SALPB Acetyl esterase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aes PE=3 SV=1 67 317 4.0E-18
sp|Q8ZRA1|AES_SALTY Acetyl esterase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aes PE=1 SV=1 67 317 6.0E-18
sp|Q5PFJ2|AES_SALPA Acetyl esterase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aes PE=3 SV=1 67 317 6.0E-18
sp|B4SWY4|AES_SALNS Acetyl esterase OS=Salmonella newport (strain SL254) GN=aes PE=3 SV=1 67 317 6.0E-18
sp|P18773|EST_ACILW Esterase OS=Acinetobacter lwoffii GN=est PE=3 SV=2 86 331 6.0E-18
sp|Q9SX25|CXE6_ARATH Probable carboxylesterase 6 OS=Arabidopsis thaliana GN=CXE6 PE=2 SV=1 86 310 6.0E-18
sp|B5BD42|AES_SALPK Acetyl esterase OS=Salmonella paratyphi A (strain AKU_12601) GN=aes PE=3 SV=1 67 317 6.0E-18
sp|Q57S73|AES_SALCH Acetyl esterase OS=Salmonella choleraesuis (strain SC-B67) GN=aes PE=3 SV=1 67 317 7.0E-18
sp|Q9MAA7|GID1A_ARATH Gibberellin receptor GID1A OS=Arabidopsis thaliana GN=GID1A PE=1 SV=1 80 295 1.0E-17
sp|Q8Z8T1|AES_SALTI Acetyl esterase OS=Salmonella typhi GN=aes PE=3 SV=1 67 317 1.0E-17
sp|Q0T7A9|AES_SHIF8 Acetyl esterase OS=Shigella flexneri serotype 5b (strain 8401) GN=aes PE=3 SV=1 72 319 1.0E-17
sp|B7UKF6|AES_ECO27 Acetyl esterase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aes PE=3 SV=1 72 319 1.0E-17
sp|B1IZB8|AES_ECOLC Acetyl esterase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aes PE=3 SV=1 72 319 1.0E-17
sp|B1LJN4|AES_ECOSM Acetyl esterase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aes PE=3 SV=1 72 319 1.0E-17
sp|P23872|AES_ECOLI Acetyl esterase OS=Escherichia coli (strain K12) GN=aes PE=1 SV=3 72 319 1.0E-17
sp|B1XFR3|AES_ECODH Acetyl esterase OS=Escherichia coli (strain K12 / DH10B) GN=aes PE=3 SV=1 72 319 1.0E-17
sp|C4ZUT0|AES_ECOBW Acetyl esterase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aes PE=3 SV=1 72 319 1.0E-17
sp|B7NIF4|AES_ECO7I Acetyl esterase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aes PE=3 SV=1 72 319 1.0E-17
sp|B7N929|AES_ECOLU Acetyl esterase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aes PE=3 SV=1 72 319 1.0E-17
sp|B7MQJ1|AES_ECO81 Acetyl esterase OS=Escherichia coli O81 (strain ED1a) GN=aes PE=3 SV=1 72 319 2.0E-17
sp|Q3Z4S3|AES_SHISS Acetyl esterase OS=Shigella sonnei (strain Ss046) GN=aes PE=3 SV=1 72 319 2.0E-17
sp|A7ZXD4|AES_ECOHS Acetyl esterase OS=Escherichia coli O9:H4 (strain HS) GN=aes PE=3 SV=1 72 319 2.0E-17
sp|B7M3W8|AES_ECO8A Acetyl esterase OS=Escherichia coli O8 (strain IAI1) GN=aes PE=3 SV=1 72 319 2.0E-17
sp|B5QU79|AES_SALEP Acetyl esterase OS=Salmonella enteritidis PT4 (strain P125109) GN=aes PE=3 SV=1 67 317 2.0E-17
sp|B5FLK0|AES_SALDC Acetyl esterase OS=Salmonella dublin (strain CT_02021853) GN=aes PE=3 SV=1 67 317 2.0E-17
sp|A7ZIN6|AES_ECO24 Acetyl esterase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aes PE=3 SV=1 72 319 2.0E-17
sp|Q0TKG5|AES_ECOL5 Acetyl esterase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aes PE=3 SV=1 72 317 3.0E-17
sp|Q83M39|AES_SHIFL Acetyl esterase OS=Shigella flexneri GN=aes PE=3 SV=2 72 319 3.0E-17
sp|Q8FK82|AES_ECOL6 Acetyl esterase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aes PE=3 SV=1 72 319 3.0E-17
sp|B6I0B9|AES_ECOSE Acetyl esterase OS=Escherichia coli (strain SE11) GN=aes PE=3 SV=1 72 319 3.0E-17
sp|B7L7A1|AES_ECO55 Acetyl esterase OS=Escherichia coli (strain 55989 / EAEC) GN=aes PE=3 SV=1 72 319 3.0E-17
sp|B5Z3Y7|AES_ECO5E Acetyl esterase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aes PE=3 SV=1 72 319 4.0E-17
sp|Q8XD38|AES_ECO57 Acetyl esterase OS=Escherichia coli O157:H7 GN=aes PE=3 SV=1 72 319 4.0E-17
sp|Q1RF59|AES_ECOUT Acetyl esterase OS=Escherichia coli (strain UTI89 / UPEC) GN=aes PE=3 SV=1 72 319 5.0E-17
sp|A1A8E2|AES_ECOK1 Acetyl esterase OS=Escherichia coli O1:K1 / APEC GN=aes PE=3 SV=1 72 319 5.0E-17
sp|B7MDZ8|AES_ECO45 Acetyl esterase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aes PE=3 SV=1 72 319 5.0E-17
sp|B2U4S9|AES_SHIB3 Acetyl esterase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aes PE=3 SV=1 72 319 5.0E-17
sp|Q325C0|AES_SHIBS Acetyl esterase OS=Shigella boydii serotype 4 (strain Sb227) GN=aes PE=3 SV=1 72 319 8.0E-17
sp|Q0P5B7|AAAD_BOVIN Arylacetamide deacetylase OS=Bos taurus GN=AADAC PE=2 SV=1 60 308 2.0E-16
sp|Q9EX73|MLHB_RHOER Monoterpene epsilon-lactone hydrolase OS=Rhodococcus erythropolis GN=mlhB PE=1 SV=1 90 303 4.0E-16
sp|Q7M370|AAAD_RABIT Arylacetamide deacetylase OS=Oryctolagus cuniculus GN=AADAC PE=1 SV=1 91 322 8.0E-16
sp|Q9LMA7|CXE1_ARATH Probable carboxylesterase 1 OS=Arabidopsis thaliana GN=CXE1 PE=2 SV=1 67 326 1.0E-15
sp|Q9FX92|CXE3_ARATH Probable carboxylesterase 3 OS=Arabidopsis thaliana GN=CXE3 PE=2 SV=1 72 189 5.0E-15
sp|Q940G6|GID1C_ARATH Gibberellin receptor GID1C OS=Arabidopsis thaliana GN=GID1C PE=1 SV=1 80 295 7.0E-15
sp|Q1JQE6|NCEH1_BOVIN Neutral cholesterol ester hydrolase 1 OS=Bos taurus GN=NCEH1 PE=2 SV=2 71 303 7.0E-15
sp|Q5NUF4|HIDM_GLYEC 2-hydroxyisoflavanone dehydratase OS=Glycyrrhiza echinata GN=HIDM PE=1 SV=1 59 305 1.0E-14
sp|Q8BLF1|NCEH1_MOUSE Neutral cholesterol ester hydrolase 1 OS=Mus musculus GN=Nceh1 PE=1 SV=1 71 303 1.0E-14
sp|Q6PIU2|NCEH1_HUMAN Neutral cholesterol ester hydrolase 1 OS=Homo sapiens GN=NCEH1 PE=1 SV=3 71 303 3.0E-14
sp|Q5R8Y5|NCEH1_PONAB Neutral cholesterol ester hydrolase 1 OS=Pongo abelii GN=NCEH1 PE=2 SV=1 71 303 5.0E-14
sp|Q0ZPV7|CXE1_ACTER Carboxylesterase 1 OS=Actinidia eriantha GN=CXE1 PE=1 SV=1 67 322 6.0E-14
sp|P14326|VSH5_DICDI Vegetative-specific protein H5 OS=Dictyostelium discoideum GN=cinB PE=2 SV=2 63 313 6.0E-14
sp|Q6UEG5|AFLJ_ASPPA Versiconal hemiacetal acetate esterase OS=Aspergillus parasiticus GN=estA PE=1 SV=1 69 319 8.0E-14
sp|B2GV54|NCEH1_RAT Neutral cholesterol ester hydrolase 1 OS=Rattus norvegicus GN=Nceh1 PE=2 SV=1 71 303 9.0E-14
sp|P22760|AAAD_HUMAN Arylacetamide deacetylase OS=Homo sapiens GN=AADAC PE=1 SV=5 60 264 9.0E-14
sp|R4X4V6|TCEB2_TULGE Tuliposide A-converting enzyme b2, amyloplastic OS=Tulipa gesneriana GN=TCEA-B2 PE=1 SV=1 60 305 1.0E-13
sp|R4X244|TCEB1_TULGE Tuliposide A-converting enzyme b1, amyloplastic OS=Tulipa gesneriana GN=TCEA-B1 PE=1 SV=1 60 290 1.0E-13
sp|R4X247|TCEB4_TULGE Probable tuliposide A-converting enzyme b6, amyloplastic OS=Tulipa gesneriana GN=TCEA-B6 PE=2 SV=1 60 305 1.0E-13
sp|Q9LYC1|GID1B_ARATH Gibberellin receptor GID1B OS=Arabidopsis thaliana GN=GID1B PE=1 SV=1 89 299 1.0E-13
sp|Q9LVB8|CXE20_ARATH Probable carboxylesterase 120 OS=Arabidopsis thaliana GN=CXE20 PE=2 SV=1 64 303 1.0E-13
sp|Q9SX78|CXE2_ARATH Probable carboxylesterase 2 OS=Arabidopsis thaliana GN=CXE2 PE=2 SV=1 48 314 2.0E-13
sp|Q99PG0|AAAD_MOUSE Arylacetamide deacetylase OS=Mus musculus GN=Aadac PE=1 SV=3 91 264 4.0E-13
sp|R4X5P0|TCEB3_TULGE Tuliposide A-converting enzyme b3, amyloplastic OS=Tulipa gesneriana GN=TCEA-B3 PE=1 SV=1 60 290 4.0E-13
sp|Q8LED9|CXE16_ARATH Probable carboxylesterase 16 OS=Arabidopsis thaliana GN=CXE16 PE=2 SV=1 77 312 5.0E-13
sp|Q9LK21|CXE11_ARATH Probable carboxylesterase 11 OS=Arabidopsis thaliana GN=CXE11 PE=2 SV=1 89 312 7.0E-13
sp|O06350|LIPF_MYCTU Carboxylesterase LipF OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lipF PE=1 SV=3 85 305 8.0E-13
sp|Q9SMN0|CXE12_ARATH Probable carboxylesterase 12 OS=Arabidopsis thaliana GN=CXE12 PE=1 SV=1 72 189 8.0E-13
sp|Q9FX94|CXE5_ARATH Probable carboxylesterase 5 OS=Arabidopsis thaliana GN=CXE5 PE=2 SV=1 64 187 8.0E-13
sp|Q9FX93|CXE4_ARATH Probable carboxylesterase 4 OS=Arabidopsis thaliana GN=CXE4 PE=2 SV=1 67 205 1.0E-12
sp|Q9QZH8|AAAD_RAT Arylacetamide deacetylase OS=Rattus norvegicus GN=Aadac PE=2 SV=3 91 308 1.0E-12
sp|Q6L545|GID1_ORYSJ Gibberellin receptor GID1 OS=Oryza sativa subsp. japonica GN=GID1 PE=1 SV=1 3 295 2.0E-12
sp|Q5VUY0|ADCL3_HUMAN Arylacetamide deacetylase-like 3 OS=Homo sapiens GN=AADACL3 PE=2 SV=4 89 296 2.0E-12
sp|Q6P093|ADCL2_HUMAN Arylacetamide deacetylase-like 2 OS=Homo sapiens GN=AADACL2 PE=2 SV=3 74 293 3.0E-12
sp|I4DST9|TCEA2_TULGE Tuliposide A-converting enzyme 2, chloroplastic OS=Tulipa gesneriana GN=TCEA2 PE=1 SV=1 67 290 4.0E-12
sp|I4DST8|TCEA1_TULGE Tuliposide A-converting enzyme 1, chloroplastic OS=Tulipa gesneriana GN=TCEA1 PE=1 SV=1 67 290 4.0E-12
sp|Q9ZQ91|CXE7_ARATH Probable carboxylesterase 7 OS=Arabidopsis thaliana GN=CXE7 PE=2 SV=1 64 191 2.0E-11
sp|Q9SMM9|CXE13_ARATH Probable carboxylesterase 13 OS=Arabidopsis thaliana GN=CXE13 PE=1 SV=1 89 309 2.0E-11
sp|Q5NUF3|HIDH_SOYBN 2-hydroxyisoflavanone dehydratase OS=Glycine max GN=HIDH PE=1 SV=1 60 186 3.0E-11
sp|Q9LT10|CXE18_ARATH Probable carboxylesterase 18 OS=Arabidopsis thaliana GN=CXE18 PE=1 SV=1 72 202 9.0E-11
sp|O64641|CXE9_ARATH Probable carboxylesterase 9 OS=Arabidopsis thaliana GN=CXE9 PE=2 SV=1 71 309 6.0E-10
sp|Q00675|STCI_EMENI Putative sterigmatocystin biosynthesis lipase/esterase stcI OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcI PE=3 SV=1 69 303 3.0E-09
sp|Q01109|BAH_STRHY Acetyl-hydrolase OS=Streptomyces hygroscopicus GN=bah PE=3 SV=3 90 336 7.0E-09
sp|Q8BM81|ADCL4_MOUSE Arylacetamide deacetylase-like 4 OS=Mus musculus GN=Aadacl4 PE=2 SV=2 74 231 8.0E-09
sp|Q9FG13|CXE15_ARATH Probable carboxylesterase 15 OS=Arabidopsis thaliana GN=CXE15 PE=2 SV=1 113 307 4.0E-08
sp|A2A7Z8|ADCL3_MOUSE Arylacetamide deacetylase-like 3 OS=Mus musculus GN=Aadacl3 PE=3 SV=1 61 309 1.0E-07
sp|Q566U4|KFA_DANRE Kynurenine formamidase OS=Danio rerio GN=afmid PE=2 SV=2 40 206 7.0E-07
sp|Q5VUY2|ADCL4_HUMAN Arylacetamide deacetylase-like 4 OS=Homo sapiens GN=AADACL4 PE=3 SV=1 61 232 8.0E-07
sp|Q05469|LIPS_HUMAN Hormone-sensitive lipase OS=Homo sapiens GN=LIPE PE=1 SV=4 90 185 1.0E-06
sp|P15304|LIPS_RAT Hormone-sensitive lipase OS=Rattus norvegicus GN=Lipe PE=1 SV=3 90 185 1.0E-06
sp|Q9R101|LIPS_ICTTR Hormone-sensitive lipase OS=Ictidomys tridecemlineatus GN=LIPE PE=2 SV=1 90 185 3.0E-06
sp|P54310|LIPS_MOUSE Hormone-sensitive lipase OS=Mus musculus GN=Lipe PE=1 SV=2 90 185 4.0E-06
sp|Q68J42|LIPS_PIG Hormone-sensitive lipase OS=Sus scrofa GN=LIPE PE=2 SV=1 90 185 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3034
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7051 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4574
Ophiocordyceps camponoti-floridani Ophcf2|01658
Ophiocordyceps camponoti-rufipedis Ophun1|1301
Ophiocordyceps kimflemingae Ophio5|3691
Ophiocordyceps subramaniannii Hirsu2|5241

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7051
MAYPLHPSVLGRIDAQYAAFYNTYLANNPPTHLQPLSTARAAFVSLKPGTGPLLAVGHVQDLLVPRNPLPALTVR
CFTPQGPVPDSGWPVLLYFHGGGWVLGNRETENTVATNICVRASCVVVTVEYRLAPEDPFPAAVQDAWDSLVWVR
SAGASALSLNVDRLAVGGSSAGANLAAVVCQRDASQRCSSSSPPIRLQLLSVPVVDNTATIDTSPSWSANQHTPS
LPADKMTWFRNLYLPDEQQRHLPEASPLLWKGDWASLPPAVVLLAELDVLLDEGKMFAQKLADAGVDVDVHIFKG
QPHPFLALDKVLDDGRRAMTYFCEAMARLALSSDFKQE*
Coding >OphauG2|7051
ATGGCCTACCCTCTACATCCCTCCGTCCTTGGCCGCATTGATGCTCAATACGCCGCCTTCTACAACACTTACTTG
GCCAATAATCCCCCCACCCACCTGCAACCATTGTCTACGGCTCGTGCCGCGTTTGTAAGCTTGAAGCCTGGCACA
GGGCCACTTCTGGCCGTCGGCCACGTCCAAGACTTGCTAGTGCCTAGAAACCCTCTCCCGGCCCTGACTGTGCGA
TGCTTTACGCCTCAGGGTCCAGTGCCCGACTCGGGCTGGCCAGTTCTGCTCTATTTTCACGGCGGCGGCTGGGTC
TTGGGCAACCGGGAGACTGAGAATACTGTAGCCACCAATATCTGTGTGCGGGCGTCGTGTGTTGTCGTCACTGTC
GAGTACAGACTTGCTCCCGAAGACCCCTTCCCGGCTGCCGTCCAGGACGCCTGGGATTCTCTTGTCTGGGTCCGA
AGTGCTGGTGCATCGGCGCTATCGCTCAACGTTGATCGTCTTGCCGTCGGTGGTTCTTCCGCAGGAGCCAACCTT
GCCGCAGTGGTCTGTCAGCGCGACGCCTCGCAAAGGTGCTCGAGCTCGTCTCCGCCCATTCGACTGCAGCTCTTG
TCTGTCCCGGTCGTGGACAACACAGCCACCATCGACACAAGCCCATCGTGGTCCGCCAACCAGCATACCCCGAGT
CTGCCGGCTGACAAGATGACCTGGTTCCGCAACTTATACTTGCCTGACGAGCAGCAGCGCCACCTGCCAGAGGCT
AGTCCGCTATTGTGGAAGGGCGACTGGGCCTCTCTTCCGCCCGCCGTGGTGCTTCTTGCCGAACTCGATGTGCTC
CTTGACGAGGGCAAAATGTTTGCCCAGAAGCTGGCGGATGCAGGAGTCGACGTTGACGTGCACATTTTCAAGGGC
CAGCCACATCCCTTCTTGGCCCTGGATAAGGTACTTGACGACGGGCGGCGAGCAATGACCTATTTTTGCGAGGCC
ATGGCCAGATTGGCCTTGAGTTCTGATTTCAAGCAAGAGTAG
Transcript >OphauG2|7051
ATGGCCTACCCTCTACATCCCTCCGTCCTTGGCCGCATTGATGCTCAATACGCCGCCTTCTACAACACTTACTTG
GCCAATAATCCCCCCACCCACCTGCAACCATTGTCTACGGCTCGTGCCGCGTTTGTAAGCTTGAAGCCTGGCACA
GGGCCACTTCTGGCCGTCGGCCACGTCCAAGACTTGCTAGTGCCTAGAAACCCTCTCCCGGCCCTGACTGTGCGA
TGCTTTACGCCTCAGGGTCCAGTGCCCGACTCGGGCTGGCCAGTTCTGCTCTATTTTCACGGCGGCGGCTGGGTC
TTGGGCAACCGGGAGACTGAGAATACTGTAGCCACCAATATCTGTGTGCGGGCGTCGTGTGTTGTCGTCACTGTC
GAGTACAGACTTGCTCCCGAAGACCCCTTCCCGGCTGCCGTCCAGGACGCCTGGGATTCTCTTGTCTGGGTCCGA
AGTGCTGGTGCATCGGCGCTATCGCTCAACGTTGATCGTCTTGCCGTCGGTGGTTCTTCCGCAGGAGCCAACCTT
GCCGCAGTGGTCTGTCAGCGCGACGCCTCGCAAAGGTGCTCGAGCTCGTCTCCGCCCATTCGACTGCAGCTCTTG
TCTGTCCCGGTCGTGGACAACACAGCCACCATCGACACAAGCCCATCGTGGTCCGCCAACCAGCATACCCCGAGT
CTGCCGGCTGACAAGATGACCTGGTTCCGCAACTTATACTTGCCTGACGAGCAGCAGCGCCACCTGCCAGAGGCT
AGTCCGCTATTGTGGAAGGGCGACTGGGCCTCTCTTCCGCCCGCCGTGGTGCTTCTTGCCGAACTCGATGTGCTC
CTTGACGAGGGCAAAATGTTTGCCCAGAAGCTGGCGGATGCAGGAGTCGACGTTGACGTGCACATTTTCAAGGGC
CAGCCACATCCCTTCTTGGCCCTGGATAAGGTACTTGACGACGGGCGGCGAGCAATGACCTATTTTTGCGAGGCC
ATGGCCAGATTGGCCTTGAGTTCTGATTTCAAGCAAGAGTAG
Gene >OphauG2|7051
ATGGCCTACCCTCTACATCCCTCCGTCCTTGGCCGCATTGATGCTCAATACGCCGCCTTCTACAACACTTACTTG
GCCAATAATCCCCCCACCCACCTGCAACCATTGTCTACGGCTCGTGCCGCGTTTGTAAGCTTGAAGCCTGGCACA
GGGCCACTTCTGGCCGTCGGCCACGTCCAAGACTTGCTAGTGCCTAGAAACCCTCTCCCGGCCCTGACTGTGCGA
TGCTTTACGCCTCAGGGTCCAGTGCCCGACTCGGGCTGGCCAGTTCTGCTCTATTTTCACGGCGGCGGCTGGGTC
TTGGGCAACCGGGAGACTGAGAATACTGTAGCCACCAATATCTGTGTGCGGGCGTCGTGTGTTGTCGTCACTGTC
GAGTACAGGTATTTCCCCCTTGGCCTCTTTATGTGGCGGCTCTGCCACGCTCATAACATGACACAGACTTGCTCC
CGAAGACCCCTTCCCGGCTGCCGTCCAGGACGCCTGGGATTCTCTTGTCTGGGTCCGAAGTGCTGGTGCATCGGC
GCTATCGCTCAACGTTGATCGTCTTGCCGTCGGTGGTTCTTCCGCAGGAGCCAACCTTGCCGCAGTGGTCTGTCA
GCGCGACGCCTCGCAAAGGTGCTCGAGCTCGTCTCCGCCCATTCGACTGCAGCTCTTGTCTGTCCCGGTCGTGGA
CAACACAGCCACCATCGACACAAGCCCATCGTGGTCCGCCAACCAGCATACCCCGAGTCTGCCGGCTGACAAGAT
GACCTGGTTCCGCAACTTATACTTGCCTGACGAGCAGCAGCGCCACCTGCCAGAGGCTAGTCCGCTATTGTGGAA
GGGCGACTGGGCCTCTCTTCCGCCCGCCGTGGTGCTTCTTGCCGAACTCGATGTGCTCCTTGACGAGGGCAAAAT
GTTTGCCCAGAAGCTGGCGGATGCAGGAGTCGACGTTGACGTGCACATTTTCAAGGGCCAGCCACATCCCTTCTT
GGCCCTGGATAAGGTACTTGACGACGGGCGGCGAGCAATGACCTATTTTTGCGAGGCCATGGCCAGATTGGCCTT
GAGTTCTGATTTCAAGCAAGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail