Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7045
Gene name
LocationContig_783:5256..6937
Strand+
Gene length (bp)1681
Transcript length (bp)1617
Coding sequence length (bp)1617
Protein length (aa) 539

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00890 FAD_binding_2 FAD binding domain 1.1E-41 10 504
PF01266 DAO FAD dependent oxidoreductase 4.3E-14 10 205
PF12831 FAD_oxidored FAD dependent oxidoreductase 2.5E-07 10 46
PF03486 HI0933_like HI0933-like protein 4.5E-06 10 47
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.3E-05 13 45

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59327|OASD_COMTE 3-oxo-5-alpha-steroid 4-dehydrogenase OS=Comamonas testosteroni PE=1 SV=1 25 499 2.0E-68
sp|P83223|FRDA_SHEON Fumarate reductase flavoprotein subunit OS=Shewanella oneidensis (strain MR-1) GN=SO_0970 PE=1 SV=2 1 530 3.0E-17
sp|Q07WU7|FRDA_SHEFN Fumarate reductase flavoprotein subunit OS=Shewanella frigidimarina (strain NCIMB 400) GN=fccA PE=1 SV=2 23 530 4.0E-16
sp|P0C278|FRDA_SHEFR Fumarate reductase flavoprotein subunit OS=Shewanella frigidimarina GN=fccA PE=1 SV=1 23 530 5.0E-16
sp|O13755|OSM1_SCHPO Fumarate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=osm1 PE=3 SV=1 2 530 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59327|OASD_COMTE 3-oxo-5-alpha-steroid 4-dehydrogenase OS=Comamonas testosteroni PE=1 SV=1 25 499 2.0E-68
sp|P83223|FRDA_SHEON Fumarate reductase flavoprotein subunit OS=Shewanella oneidensis (strain MR-1) GN=SO_0970 PE=1 SV=2 1 530 3.0E-17
sp|Q07WU7|FRDA_SHEFN Fumarate reductase flavoprotein subunit OS=Shewanella frigidimarina (strain NCIMB 400) GN=fccA PE=1 SV=2 23 530 4.0E-16
sp|P0C278|FRDA_SHEFR Fumarate reductase flavoprotein subunit OS=Shewanella frigidimarina GN=fccA PE=1 SV=1 23 530 5.0E-16
sp|O13755|OSM1_SCHPO Fumarate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=osm1 PE=3 SV=1 2 530 2.0E-12
sp|Q9Z4P0|FRD2_SHEFN Fumarate reductase flavoprotein subunit OS=Shewanella frigidimarina (strain NCIMB 400) GN=ifcA PE=1 SV=1 260 533 3.0E-10
sp|Q8CVD0|URDA_SHEON Urocanate reductase OS=Shewanella oneidensis (strain MR-1) GN=urdA PE=1 SV=1 10 530 2.0E-09
sp|P32614|FRDS_YEAST Fumarate reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRD1 PE=1 SV=1 251 526 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7045
MADDTQKKPDVIVVGGGLSGMCAAVAAAEEGARVTVLDRGFGGGASFISGGVVYAGGGTKYQAQAGYHDTPDNMF
CYLKHEAGNVVDDAVLRRFCNESVSNLEWLEGHGARFSGAMPSFRTSYPAGEYHLHYSGNEMAFSAASVAKPAPR
GHRAVGQGLSEMEMTGAALWGAIYHSALRLGVRLEPAARVDKLLADSEGRVKGVGYRCLSDSAPWLVASYKWLTH
SANRYQTMIPALSRLYNGVASFIWHKGAVQKCLEAPAVILAAGGFIMNDEMTRAFVPWASQTAPLGTAGDDGQGI
RLGQSVRGRVSHMDRMSAWRFIYPPEALSEGIVLSPKGERLMAEDSYGAFLTEAMMKRASGHGFLILDSLQWEKF
KSQIQVQTRGMWRFLVNYIRVWHHKSATSIEELANKFSIDASNMREAVEAYNKAIINSEPDPVEKVNYRSVISSP
PFYGIDISVRSSGFMMVLGLTLGGLDVDGETGMVLNEEGKTIPGLYAAGRNAVGICSNRYVSGLSLADCVFSGRR
AGRHAFQNQTTWR*
Coding >OphauG2|7045
ATGGCCGACGACACGCAGAAGAAGCCAGACGTCATTGTTGTTGGAGGCGGCCTTTCGGGCATGTGCGCCGCCGTG
GCGGCTGCTGAGGAGGGCGCCCGCGTCACGGTTCTGGATCGCGGCTTTGGCGGCGGCGCGTCCTTCATTTCAGGG
GGCGTGGTGTACGCAGGAGGCGGCACCAAGTATCAGGCACAAGCGGGATACCACGATACTCCTGACAATATGTTT
TGTTACCTGAAGCATGAAGCTGGAAACGTGGTTGACGACGCTGTGTTGAGGAGATTCTGCAACGAGAGCGTCTCT
AATCTCGAGTGGTTGGAAGGGCACGGGGCGAGATTCTCGGGCGCCATGCCGTCGTTTAGAACCAGCTATCCCGCG
GGGGAATACCATCTCCATTACTCGGGGAATGAAATGGCGTTCTCTGCGGCCTCGGTGGCCAAGCCGGCGCCTCGG
GGCCATCGGGCCGTGGGCCAGGGGCTCAGCGAGATGGAAATGACGGGTGCGGCTCTCTGGGGCGCCATTTACCAC
TCGGCCCTGAGACTGGGTGTCAGGCTTGAGCCGGCCGCCAGGGTGGACAAGTTGTTGGCCGACAGTGAGGGACGA
GTAAAGGGAGTGGGCTATCGCTGCTTGAGCGACTCTGCTCCATGGCTGGTCGCGTCGTACAAGTGGCTGACGCAC
AGTGCCAACCGGTATCAAACCATGATTCCCGCCTTGTCCAGGCTCTACAATGGGGTTGCAAGTTTCATCTGGCAC
AAGGGGGCTGTGCAAAAATGCCTCGAGGCGCCTGCTGTCATTCTGGCTGCTGGAGGCTTCATCATGAATGATGAA
ATGACGCGGGCTTTTGTCCCTTGGGCCTCCCAGACGGCGCCGCTGGGAACGGCCGGGGACGATGGACAGGGCATC
AGGCTCGGCCAATCAGTCCGCGGCCGCGTCTCGCACATGGACCGCATGTCAGCTTGGAGGTTTATCTATCCGCCC
GAAGCCCTAAGCGAGGGCATCGTGCTATCTCCCAAGGGCGAGCGACTCATGGCTGAAGATTCATACGGGGCTTTT
TTGACAGAAGCCATGATGAAGCGAGCCAGTGGCCACGGGTTTCTGATTCTCGATTCCTTGCAGTGGGAGAAATTC
AAGAGCCAGATCCAGGTCCAGACACGCGGCATGTGGAGATTTCTCGTCAACTACATCAGGGTGTGGCATCACAAG
AGCGCAACGTCGATTGAGGAGCTGGCAAACAAGTTTTCAATAGACGCAAGCAACATGCGGGAAGCTGTTGAAGCG
TACAACAAGGCGATTATAAACAGCGAGCCAGACCCAGTTGAAAAGGTGAATTATCGATCTGTTATTTCCTCGCCC
CCATTCTATGGGATTGATATCTCTGTGAGGTCGAGCGGCTTCATGATGGTCCTGGGGCTGACTCTTGGCGGGCTT
GATGTTGACGGGGAGACGGGCATGGTTCTGAATGAAGAAGGAAAGACGATTCCAGGACTGTATGCTGCGGGGAGG
AATGCTGTTGGGATCTGCTCGAATCGCTACGTGTCGGGGCTGTCTCTTGCAGATTGTGTGTTTTCGGGGCGAAGA
GCAGGACGGCATGCTTTCCAGAACCAGACTACTTGGAGATGA
Transcript >OphauG2|7045
ATGGCCGACGACACGCAGAAGAAGCCAGACGTCATTGTTGTTGGAGGCGGCCTTTCGGGCATGTGCGCCGCCGTG
GCGGCTGCTGAGGAGGGCGCCCGCGTCACGGTTCTGGATCGCGGCTTTGGCGGCGGCGCGTCCTTCATTTCAGGG
GGCGTGGTGTACGCAGGAGGCGGCACCAAGTATCAGGCACAAGCGGGATACCACGATACTCCTGACAATATGTTT
TGTTACCTGAAGCATGAAGCTGGAAACGTGGTTGACGACGCTGTGTTGAGGAGATTCTGCAACGAGAGCGTCTCT
AATCTCGAGTGGTTGGAAGGGCACGGGGCGAGATTCTCGGGCGCCATGCCGTCGTTTAGAACCAGCTATCCCGCG
GGGGAATACCATCTCCATTACTCGGGGAATGAAATGGCGTTCTCTGCGGCCTCGGTGGCCAAGCCGGCGCCTCGG
GGCCATCGGGCCGTGGGCCAGGGGCTCAGCGAGATGGAAATGACGGGTGCGGCTCTCTGGGGCGCCATTTACCAC
TCGGCCCTGAGACTGGGTGTCAGGCTTGAGCCGGCCGCCAGGGTGGACAAGTTGTTGGCCGACAGTGAGGGACGA
GTAAAGGGAGTGGGCTATCGCTGCTTGAGCGACTCTGCTCCATGGCTGGTCGCGTCGTACAAGTGGCTGACGCAC
AGTGCCAACCGGTATCAAACCATGATTCCCGCCTTGTCCAGGCTCTACAATGGGGTTGCAAGTTTCATCTGGCAC
AAGGGGGCTGTGCAAAAATGCCTCGAGGCGCCTGCTGTCATTCTGGCTGCTGGAGGCTTCATCATGAATGATGAA
ATGACGCGGGCTTTTGTCCCTTGGGCCTCCCAGACGGCGCCGCTGGGAACGGCCGGGGACGATGGACAGGGCATC
AGGCTCGGCCAATCAGTCCGCGGCCGCGTCTCGCACATGGACCGCATGTCAGCTTGGAGGTTTATCTATCCGCCC
GAAGCCCTAAGCGAGGGCATCGTGCTATCTCCCAAGGGCGAGCGACTCATGGCTGAAGATTCATACGGGGCTTTT
TTGACAGAAGCCATGATGAAGCGAGCCAGTGGCCACGGGTTTCTGATTCTCGATTCCTTGCAGTGGGAGAAATTC
AAGAGCCAGATCCAGGTCCAGACACGCGGCATGTGGAGATTTCTCGTCAACTACATCAGGGTGTGGCATCACAAG
AGCGCAACGTCGATTGAGGAGCTGGCAAACAAGTTTTCAATAGACGCAAGCAACATGCGGGAAGCTGTTGAAGCG
TACAACAAGGCGATTATAAACAGCGAGCCAGACCCAGTTGAAAAGGTGAATTATCGATCTGTTATTTCCTCGCCC
CCATTCTATGGGATTGATATCTCTGTGAGGTCGAGCGGCTTCATGATGGTCCTGGGGCTGACTCTTGGCGGGCTT
GATGTTGACGGGGAGACGGGCATGGTTCTGAATGAAGAAGGAAAGACGATTCCAGGACTGTATGCTGCGGGGAGG
AATGCTGTTGGGATCTGCTCGAATCGCTACGTGTCGGGGCTGTCTCTTGCAGATTGTGTGTTTTCGGGGCGAAGA
GCAGGACGGCATGCTTTCCAGAACCAGACTACTTGGAGATGA
Gene >OphauG2|7045
ATGGCCGACGACACGCAGAAGAAGCCAGACGTCATTGTTGTTGGAGGCGGCCTTTCGGGCATGTGCGCCGCCGTG
GCGGCTGCTGAGGAGGGCGCCCGCGTCACGGTTCTGGATCGCGGCTTTGGCGGCGGCGCGTCCTTCATTTCAGGG
GGCGTGGTGTACGCAGGAGGCGGCACCAAGTATCAGGCACAAGCGGGATACCACGATACTCCTGACAATATGTTT
TGTTACCTGAAGCATGAAGCTGGAAACGTGGTTGACGACGCTGTGTTGAGGAGATTCTGCAACGAGAGCGTCTCT
AATCTCGAGTGGTTGGAAGGGCACGGGGCGAGATTCTCGGGCGCCATGCCGTCGTTTAGAACCAGCTATCCCGCG
GGGGAATACCATCTCCATTACTCGGGGAATGAAATGGCGTTCTCTGCGGCCTCGGTGGCCAAGCCGGCGCCTCGG
GGCCATCGGGCCGTGGGCCAGGGGCTCAGCGAGATGGAAATGACGGGTGCGGCTCTCTGGGGCGCCATTTACCAC
TCGGCCCTGAGACTGGGTGTCAGGCTTGAGCCGGCCGCCAGGGTGGACAAGTTGTTGGCCGACAGTGAGGGACGA
GTAAAGGGAGTGGGCTATCGCTGCTTGAGCGACTCTGCTCCATGGCTGGTCGCGTCGTACAAGTGGCTGACGCAC
AGTGCCAACCGGTATCAAACCATGATTCCCGCCTTGTCCAGGCTCTACAATGGGGTTGCAAGTTTCATCTGGCAC
AAGGGGGCTGTGCAAAAATGCCTCGAGGCGCCTGCTGTCATTCTGGCTGCTGGAGGCTTCATCAGTGAGTGCCTC
ACCACCACACATGTCTTGCTGCCACGATAACCCCATACTCATACAAAACCAAGTGAATGATGAAATGACGCGGGC
TTTTGTCCCTTGGGCCTCCCAGACGGCGCCGCTGGGAACGGCCGGGGACGATGGACAGGGCATCAGGCTCGGCCA
ATCAGTCCGCGGCCGCGTCTCGCACATGGACCGCATGTCAGCTTGGAGGTTTATCTATCCGCCCGAAGCCCTAAG
CGAGGGCATCGTGCTATCTCCCAAGGGCGAGCGACTCATGGCTGAAGATTCATACGGGGCTTTTTTGACAGAAGC
CATGATGAAGCGAGCCAGTGGCCACGGGTTTCTGATTCTCGATTCCTTGCAGTGGGAGAAATTCAAGAGCCAGAT
CCAGGTCCAGACACGCGGCATGTGGAGATTTCTCGTCAACTACATCAGGGTGTGGCATCACAAGAGCGCAACGTC
GATTGAGGAGCTGGCAAACAAGTTTTCAATAGACGCAAGCAACATGCGGGAAGCTGTTGAAGCGTACAACAAGGC
GATTATAAACAGCGAGCCAGACCCAGTTGAAAAGGTGAATTATCGATCTGTTATTTCCTCGCCCCCATTCTATGG
GATTGATATCTCTGTGAGGTCGAGCGGCTTCATGATGGTCCTGGGGCTGACTCTTGGCGGGCTTGATGTTGACGG
GGAGACGGGCATGGTTCTGAATGAAGAAGGAAAGACGATTCCAGGACTGTATGCTGCGGGGAGGAATGCTGTTGG
GATCTGCTCGAATCGCTACGTGTCGGGGCTGTCTCTTGCAGATTGTGTGTTTTCGGGGCGAAGAGCAGGACGGCA
TGCTTTCCAGAACCAGACTACTTGGAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail