Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7035
Gene name
LocationContig_780:2457..4808
Strand-
Gene length (bp)2351
Transcript length (bp)2034
Coding sequence length (bp)2034
Protein length (aa) 678

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RGT4|MEP1_MAGO7 Extracellular metalloprotease MGG_08041 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_08041 PE=3 SV=1 472 636 8.0E-11
sp|A4RGT4|MEP1_MAGO7 Extracellular metalloprotease MGG_08041 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_08041 PE=3 SV=1 197 318 7.0E-08
sp|C9SSK8|MEP2_VERA1 Extracellular metalloprotease VDBG_07883 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_07883 PE=3 SV=1 479 623 5.0E-07
sp|E3QKH9|MEP2_COLGM Extracellular metalloprotease GLRG_06511 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_06511 PE=3 SV=1 478 625 8.0E-07
sp|D1ZSU8|MEP1_SORMK Extracellular metalloprotease SMAC_06893 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_06893 PE=3 SV=1 468 634 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RGT4|MEP1_MAGO7 Extracellular metalloprotease MGG_08041 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_08041 PE=3 SV=1 472 636 8.0E-11
sp|A4RGT4|MEP1_MAGO7 Extracellular metalloprotease MGG_08041 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_08041 PE=3 SV=1 197 318 7.0E-08
sp|C9SSK8|MEP2_VERA1 Extracellular metalloprotease VDBG_07883 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_07883 PE=3 SV=1 479 623 5.0E-07
sp|E3QKH9|MEP2_COLGM Extracellular metalloprotease GLRG_06511 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_06511 PE=3 SV=1 478 625 8.0E-07
sp|D1ZSU8|MEP1_SORMK Extracellular metalloprotease SMAC_06893 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_06893 PE=3 SV=1 468 634 1.0E-06
sp|E4USP0|MEP8_ARTGP Extracellular metalloprotease MGYG_03559 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_03559 PE=3 SV=1 478 566 2.0E-06
sp|Q871C5|MEP1_NEUCR Extracellular metalloprotease NCU07200 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B8G12.220 PE=3 SV=1 473 634 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7035
MMKRLILASLASSLAGAFPSVFECARNPCYDDILHMTGNIENLVAQCSGPDGSMRPGVTTKLVADKFVRANPSCG
ISVNHVRYYREEDFRPICNCLLQASIPRHCDSNRCWRDLYQGANESVLTLRNECATYDYGDISFQWTSFLRPPQC
GTKLHNMLVLHEHEWRPVCSCITSDYDAVYPATQKVMRQDSFGQHIIDVFLHVVYYDKGEIEGEFRHIISDVTAE
GIIFIIKSIDLTIDGTWAVGRENEAMRKALHKGDNRDLNFYMIDDVPYDNTDRIAPLTGLNSMYCTPPPFSTAWG
SERLGDPIIDGCIIGTGVYKADMADVFQRWLGTCDFKLGQCPRIGVWETVRRIHQRLAEHRYVPFPRGAVSPYSY
IQGEVSRKRHCEHIDCFDDIRAAIHLKGGNVTEHCYSGLFNSSNNLRIPRTEFPPYYMNSCGQWTYQKYYLEAFR
YHRVCQCLLQKRRARWDFTQDVLLGHDAPIVVDIFAHYIASNSRSSMALKYMDFPSIEYDMEILSHFFSATKLLF
RLKTVDLTINAAWAEGNQSARMRQALYTGGQRDLNLYFIERPNLQDFEVKNKTISVFCSFPFSAWWALLSGADPE
HDGCLIANGASIGTLAASIQHWLGVQIAVPKSCSDKRCGPRFEADDINMINTAAALNRVVPHESPQSRLRLYQAL
DV*
Coding >OphauG2|7035
ATGATGAAGAGGCTTATTCTTGCGAGCCTGGCTAGCTCGCTGGCGGGAGCCTTTCCGTCCGTGTTTGAGTGCGCT
CGCAACCCATGCTACGACGACATTTTGCACATGACGGGGAATATAGAAAACCTCGTGGCCCAATGTTCCGGGCCG
GACGGGTCGATGAGGCCCGGAGTGACGACAAAGCTAGTCGCCGACAAATTCGTTCGCGCCAATCCTAGCTGTGGC
ATCTCGGTGAACCATGTGCGGTATTACCGCGAAGAAGACTTTCGGCCGATTTGCAACTGTCTCCTGCAGGCCAGC
ATCCCGAGACACTGCGACAGCAACCGGTGCTGGAGAGATTTGTACCAGGGGGCGAATGAGTCTGTGTTGACTCTG
CGCAACGAGTGCGCCACCTATGACTACGGCGATATCTCGTTTCAGTGGACGTCATTTTTGAGGCCGCCGCAGTGT
GGGACAAAGCTTCATAACATGCTGGTTCTGCACGAGCACGAGTGGCGGCCTGTTTGTTCTTGCATCACTAGCGAC
TACGACGCTGTGTATCCGGCGACTCAAAAGGTGATGAGGCAAGACTCGTTTGGACAGCACATTATCGATGTCTTT
TTGCACGTGGTTTACTATGACAAGGGCGAAATCGAGGGCGAGTTTCGCCACATTATTTCAGACGTCACGGCAGAA
GGCATCATCTTCATCATCAAGTCTATCGACCTGACTATAGACGGGACATGGGCAGTCGGCCGAGAAAACGAGGCC
ATGCGAAAGGCGCTTCATAAAGGAGACAATCGCGACTTGAACTTTTACATGATTGACGACGTCCCGTACGACAAC
ACGGATAGAATCGCGCCTCTCACCGGACTGAATAGCATGTACTGCACTCCGCCCCCCTTTTCGACGGCCTGGGGA
TCAGAGCGGCTTGGCGACCCCATCATTGATGGCTGCATTATTGGCACGGGCGTGTACAAAGCCGACATGGCCGAT
GTCTTTCAGCGCTGGCTGGGGACTTGCGACTTTAAACTCGGCCAATGTCCCAGGATAGGCGTCTGGGAAACGGTT
CGAAGAATCCATCAGCGCCTCGCTGAACACAGATACGTGCCGTTTCCTCGAGGCGCCGTCAGCCCCTACTCGTAC
ATCCAAGGCGAGGTCAGCCGCAAGAGGCATTGCGAGCACATCGATTGCTTCGACGACATTCGGGCGGCTATACAT
CTCAAGGGCGGCAACGTCACCGAGCATTGCTATTCAGGCTTGTTTAATAGCTCCAACAACCTAAGAATACCCCGG
ACAGAATTTCCTCCATACTACATGAATTCGTGCGGCCAATGGACTTACCAAAAGTACTACCTTGAAGCCTTTCGT
TATCACCGCGTCTGCCAGTGCCTTTTGCAAAAGCGCAGGGCTCGCTGGGACTTTACGCAAGACGTGCTTTTGGGC
CACGACGCGCCCATTGTCGTCGATATCTTTGCCCACTATATTGCATCCAACTCTCGAAGCTCAATGGCTCTCAAG
TACATGGATTTCCCCAGCATAGAATACGACATGGAAATCCTCTCGCACTTCTTCAGCGCCACAAAACTCCTGTTC
CGTCTCAAAACCGTTGATCTGACCATCAACGCCGCCTGGGCCGAGGGCAACCAATCCGCCCGCATGCGCCAGGCG
CTCTACACGGGCGGCCAGCGCGACTTGAACCTCTACTTTATCGAAAGGCCCAACCTCCAAGACTTTGAGGTCAAG
AACAAGACCATTTCCGTCTTTTGCTCCTTTCCCTTCTCTGCCTGGTGGGCTCTTCTCTCAGGCGCGGATCCCGAG
CACGATGGCTGTTTGATTGCAAACGGAGCCTCAATCGGGACGCTTGCTGCCTCGATACAGCACTGGCTTGGTGTG
CAGATTGCCGTGCCCAAGTCATGCAGTGATAAACGTTGCGGGCCCAGGTTTGAGGCCGACGACATCAACATGATT
AATACTGCTGCGGCATTGAATCGTGTTGTGCCGCATGAATCGCCCCAATCTAGACTACGCTTGTATCAGGCATTG
GACGTATGA
Transcript >OphauG2|7035
ATGATGAAGAGGCTTATTCTTGCGAGCCTGGCTAGCTCGCTGGCGGGAGCCTTTCCGTCCGTGTTTGAGTGCGCT
CGCAACCCATGCTACGACGACATTTTGCACATGACGGGGAATATAGAAAACCTCGTGGCCCAATGTTCCGGGCCG
GACGGGTCGATGAGGCCCGGAGTGACGACAAAGCTAGTCGCCGACAAATTCGTTCGCGCCAATCCTAGCTGTGGC
ATCTCGGTGAACCATGTGCGGTATTACCGCGAAGAAGACTTTCGGCCGATTTGCAACTGTCTCCTGCAGGCCAGC
ATCCCGAGACACTGCGACAGCAACCGGTGCTGGAGAGATTTGTACCAGGGGGCGAATGAGTCTGTGTTGACTCTG
CGCAACGAGTGCGCCACCTATGACTACGGCGATATCTCGTTTCAGTGGACGTCATTTTTGAGGCCGCCGCAGTGT
GGGACAAAGCTTCATAACATGCTGGTTCTGCACGAGCACGAGTGGCGGCCTGTTTGTTCTTGCATCACTAGCGAC
TACGACGCTGTGTATCCGGCGACTCAAAAGGTGATGAGGCAAGACTCGTTTGGACAGCACATTATCGATGTCTTT
TTGCACGTGGTTTACTATGACAAGGGCGAAATCGAGGGCGAGTTTCGCCACATTATTTCAGACGTCACGGCAGAA
GGCATCATCTTCATCATCAAGTCTATCGACCTGACTATAGACGGGACATGGGCAGTCGGCCGAGAAAACGAGGCC
ATGCGAAAGGCGCTTCATAAAGGAGACAATCGCGACTTGAACTTTTACATGATTGACGACGTCCCGTACGACAAC
ACGGATAGAATCGCGCCTCTCACCGGACTGAATAGCATGTACTGCACTCCGCCCCCCTTTTCGACGGCCTGGGGA
TCAGAGCGGCTTGGCGACCCCATCATTGATGGCTGCATTATTGGCACGGGCGTGTACAAAGCCGACATGGCCGAT
GTCTTTCAGCGCTGGCTGGGGACTTGCGACTTTAAACTCGGCCAATGTCCCAGGATAGGCGTCTGGGAAACGGTT
CGAAGAATCCATCAGCGCCTCGCTGAACACAGATACGTGCCGTTTCCTCGAGGCGCCGTCAGCCCCTACTCGTAC
ATCCAAGGCGAGGTCAGCCGCAAGAGGCATTGCGAGCACATCGATTGCTTCGACGACATTCGGGCGGCTATACAT
CTCAAGGGCGGCAACGTCACCGAGCATTGCTATTCAGGCTTGTTTAATAGCTCCAACAACCTAAGAATACCCCGG
ACAGAATTTCCTCCATACTACATGAATTCGTGCGGCCAATGGACTTACCAAAAGTACTACCTTGAAGCCTTTCGT
TATCACCGCGTCTGCCAGTGCCTTTTGCAAAAGCGCAGGGCTCGCTGGGACTTTACGCAAGACGTGCTTTTGGGC
CACGACGCGCCCATTGTCGTCGATATCTTTGCCCACTATATTGCATCCAACTCTCGAAGCTCAATGGCTCTCAAG
TACATGGATTTCCCCAGCATAGAATACGACATGGAAATCCTCTCGCACTTCTTCAGCGCCACAAAACTCCTGTTC
CGTCTCAAAACCGTTGATCTGACCATCAACGCCGCCTGGGCCGAGGGCAACCAATCCGCCCGCATGCGCCAGGCG
CTCTACACGGGCGGCCAGCGCGACTTGAACCTCTACTTTATCGAAAGGCCCAACCTCCAAGACTTTGAGGTCAAG
AACAAGACCATTTCCGTCTTTTGCTCCTTTCCCTTCTCTGCCTGGTGGGCTCTTCTCTCAGGCGCGGATCCCGAG
CACGATGGCTGTTTGATTGCAAACGGAGCCTCAATCGGGACGCTTGCTGCCTCGATACAGCACTGGCTTGGTGTG
CAGATTGCCGTGCCCAAGTCATGCAGTGATAAACGTTGCGGGCCCAGGTTTGAGGCCGACGACATCAACATGATT
AATACTGCTGCGGCATTGAATCGTGTTGTGCCGCATGAATCGCCCCAATCTAGACTACGCTTGTATCAGGCATTG
GACGTATGA
Gene >OphauG2|7035
ATGATGAAGAGGCTTATTCTTGCGAGCCTGGCTAGCTCGCTGGCGGGAGCCTTTCCGTCCGTGTTTGAGTGCGCT
CGCAACCCATGCTACGACGACATTTTGCACATGACGGGGAATATAGAAAACCTCGTGGCCCAATGTTCCGGGCCG
GACGGGTCGATGAGGCCCGGAGTGACGACAAAGCTAGTCGCCGACAAATTCGTTCGCGCCAATCCTAGCTGTGGC
ATCTCGGTGAACCATGTGCGGTATTACCGCGAAGAAGACTTTCGGCCGATTTGCAACTGTCTCCTGCAGGCCAGC
ATCCCGAGACACTGCGACAGCAACCGGTGCTGGAGAGATTTGTACCAGGGGGCGAATGAGTCTGTGTTGACTCTG
CGCAACGAGTGCGCCACCTATGACTACGGCGATATCTCGTTTCAGTGGACGTCATTTTTGAGGCCGCCGCAGTGT
GGGACAAAGCTTCATAACATGCTGGTTCTGCACGAGCACGAGTGGCGGCCTGTTTGTTCTTGCATCACTAGCGAC
TACGACGCTGTGTATCCGGCGACTCAAAAGGTGATGAGGCAAGACTCGTTTGGACAGCACATTATCGATGTCTTT
TTGCACGTGGTTGTGAGTTCGGGGGGGAGTTTGCGGGCAAAGCGGGTACGTGTCTTTTTTCCCCGAGTCTTTTTC
CCCGAGTCTTTTGTGTCCTTGATCCTTGGTCGTGGCCAACCAAGCCCCGAGCCTACAGTACTATGACAAGGGCGA
AATCGAGGGCGAGTTTCGCCACATTATTTCAGACGTCACGGCAGAAGGCATCATCTTCATCATCAAGTCTATCGA
CCTGACTATAGACGGGACATGGGCAGTCGGCCGAGAAAACGAGGCCATGCGAAAGGCGCTTCATAAAGGAGACAA
TCGCGACTTGAACTTTTACATGATTGACGACGTCCCGTACGACAACACGGATAGAATCGCGCCTCTCACCGGACT
GAATAGCATGTACTGCACTCCGCCCCCCTTTTCGACGGCCTGGGGATCAGAGCGGCTTGGCGACCCCATCATTGA
TGGCTGCATTATTGGCACGGGCGTGTACAAAGCCGACATGGCCGATGTCTTTCAGCGCTGGCTGGGGACTTGCGA
CTTTAAACTCGGGTGAGCAAGTCGTATATCTTACAGCGACTCGACTTGATGCAAACACTGGCTGACCTCGGCCAT
AGCCAATGTCCCAGGATAGGCGTCTGGGAAACGGTTCGAAGAATCCATCAGCGCCTCGCTGAACACAGATACGTG
CCGTTTCCTCGAGGCGCCGTCAGCCCCTACTCGTACATCCAAGGCGAGGTCAGCCGCAAGAGGCATTGCGAGCAC
ATCGATTGCTTCGACGACATTCGGGCGGCTATACATCTCAAGGGCGGCAACGTCACCGAGCATTGCTATTCAGGC
TTGTTTAATAGCTCCAACAACCTAAGAATACCCCGGACAGAATTTCCTCCATACTACATGAATTCGTGCGGCCAA
TGGACTTACCAAAAGTACTACCTTGAAGCCTTTCGTTATCACCGCGTCTGCCAGTGCCTTTTGCAAAAGCGCAGG
GCTCGCTGGGACTTTACGCAAGACGTGCTTTTGGGCCACGACGCGCCCATTGTCGTCGATATCTTTGCCCACTAT
ATTGCATCCAACTCTCGAAGCTCAATGGCTCTCAAGGTATATCGCCCGCATACCAAAGTGAATGCCAAGGTCGCA
GCTGACTTTTGCTCTTTTGCTCCTCCTAGTACATGGATTTCCCCAGCATAGAATACGACATGGAAATCCTCTCGC
ACTTCTTCAGCGCCACAAAACTCCTGTTCCGTCTCAAAACCGTTGATCTGACCATCAACGCCGCCTGGGCCGAGG
GCAACCAATCCGCCCGCATGCGCCAGGCGCTCTACACGGGCGGCCAGCGCGACTTGAACCTCTACTTTATCGAAA
GGCCCAACCTCCAAGACTTTGAGGTCAAGAACAAGACCATTTCCGTCTTTTGCTCCTTTCCCTTCTCTGCCTGGT
GGGCTCTTCTCTCAGGCGCGGATCCCGAGCACGATGGCTGTTTGATTGCAAACGGAGCCTCAATCGGGACGCTTG
CTGCCTCGATACAGCACTGGCTTGGTGTGCAGATTGCCGTGCCCAAGTCATGCAGGTATTTTGCTCTTGCTTTCT
TCCTTTTCTTCTTCCTTTTGCCCTCACAAGCTAACCATGGCAGTGATAAACGTTGCGGGCCCAGGTTTGAGGCCG
ACGACATCAACATGATTAATACTGCTGCGGCATTGAATCGTGTTGTGCCGCATGAATCGCCCCAATCTAGACTAC
GCTTGTATCAGGCATTGGACGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail