Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7031
Gene name
LocationContig_78:30355..32013
Strand+
Gene length (bp)1658
Transcript length (bp)1605
Coding sequence length (bp)1605
Protein length (aa) 535

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13899 Thioredoxin_7 Thioredoxin-like 5.1E-17 240 327
PF14555 UBA_4 UBA-like domain 3.6E-11 2 42
PF00789 UBX UBX domain 2.8E-04 454 530

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14048|UBX2_SCHPO UBX domain-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubx2 PE=1 SV=1 152 532 9.0E-47
sp|Q06682|UBX5_YEAST UBX domain-containing protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX5 PE=1 SV=1 223 531 1.0E-46
sp|Q5REY7|UBXN7_PONAB UBX domain-containing protein 7 OS=Pongo abelii GN=UBXN7 PE=2 SV=2 153 408 3.0E-28
sp|O94888|UBXN7_HUMAN UBX domain-containing protein 7 OS=Homo sapiens GN=UBXN7 PE=1 SV=2 153 408 3.0E-28
sp|Q6P5G6|UBXN7_MOUSE UBX domain-containing protein 7 OS=Mus musculus GN=Ubxn7 PE=1 SV=2 225 399 3.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14048|UBX2_SCHPO UBX domain-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubx2 PE=1 SV=1 152 532 9.0E-47
sp|Q06682|UBX5_YEAST UBX domain-containing protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX5 PE=1 SV=1 223 531 1.0E-46
sp|Q5REY7|UBXN7_PONAB UBX domain-containing protein 7 OS=Pongo abelii GN=UBXN7 PE=2 SV=2 153 408 3.0E-28
sp|O94888|UBXN7_HUMAN UBX domain-containing protein 7 OS=Homo sapiens GN=UBXN7 PE=1 SV=2 153 408 3.0E-28
sp|Q6P5G6|UBXN7_MOUSE UBX domain-containing protein 7 OS=Mus musculus GN=Ubxn7 PE=1 SV=2 225 399 3.0E-27
sp|Q55BU7|UBXN7_DICDI UBX domain-containing protein 7 homolog OS=Dictyostelium discoideum GN=ubxd7 PE=3 SV=1 223 409 2.0E-24
sp|Q94JZ8|PUX7_ARATH Plant UBX domain-containing protein 7 OS=Arabidopsis thaliana GN=PUX7 PE=1 SV=1 225 530 2.0E-21
sp|P0DKI4|PUX14_ARATH Putative plant UBX domain-containing protein 14 OS=Arabidopsis thaliana GN=PUX14 PE=5 SV=1 224 356 5.0E-15
sp|P0DKI5|PUX16_ARATH Plant UBX domain-containing protein 16 OS=Arabidopsis thaliana GN=PUX16 PE=2 SV=1 229 338 3.0E-06
sp|Q94HV8|PUX15_ARATH Putative plant UBX domain-containing protein 15 OS=Arabidopsis thaliana GN=PUX15 PE=5 SV=2 240 393 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4504
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7031 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1435
Ophiocordyceps camponoti-floridani Ophcf2|03575
Ophiocordyceps camponoti-rufipedis Ophun1|5465
Ophiocordyceps kimflemingae Ophio5|4540
Ophiocordyceps subramaniannii Hirsu2|9401

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7031
MDDDISTFISITGVSADIARGFLELTGGEFERAVGLYFENPELVQATEEFSRSGVHRQAVSSSGNIASRLAQVGR
EDSSGVIHISDDEDMLDDRDFDDEDVELTTRHGVASRNEDAAALHAANLAQEEEDAAMAKRLQEEFYGAGEESGA
GADDVRAPIARTTETLVGPDSWAPAGAGMGSEFLDQLARRQAESSSARNGPFSQRIWADGLPPPVAENGTHARRL
EDLFRPPYDLMCRTSWNEARALGKEDKKWILVNLQDMNDFTCQALNRDIWRDQVVRELLSENFIFLQYDKDYPDS
EQYMTLYLPNQGHENADNFPHVSIVDPRTGEQVKVWSGRPFPSAAEFHADLADFLDRYSLAAYSKNPVARAATRK
PKRVDVERMTEEEMLEMALKNSLEGDQGSGSQTPSNIQDPDELTKCAGQSGEGKGKEVLVQSPFEQIASNQPHTE
PENDGASTRIQFRHPAGRVIRRFQLQDPVRRIYEWLKAEPLEGKEGVEFELKKMPQGQDLIGALEATIESEGLKQ
ATVMIEFIE*
Coding >OphauG2|7031
ATGGATGACGATATCTCAACCTTCATCTCTATAACAGGCGTCAGTGCCGATATTGCCCGTGGCTTCTTGGAGCTG
ACCGGCGGCGAATTCGAGCGAGCTGTCGGTCTATACTTCGAGAACCCCGAGCTGGTACAGGCAACCGAAGAATTT
TCCCGAAGCGGCGTCCATCGGCAAGCTGTCAGCAGTTCTGGAAATATTGCATCTCGTTTAGCTCAAGTCGGAAGA
GAAGACTCTAGCGGGGTAATTCACATTAGTGACGACGAGGACATGCTGGACGATCGAGACTTTGACGACGAAGAC
GTGGAGCTAACCACGAGGCATGGAGTTGCCTCGAGGAACGAAGATGCTGCTGCTCTGCACGCTGCCAACTTGGCT
CAGGAAGAGGAAGACGCAGCCATGGCCAAACGCCTCCAGGAAGAGTTTTACGGAGCAGGCGAGGAATCTGGAGCT
GGCGCAGACGACGTAAGAGCTCCCATTGCAAGAACTACAGAGACCCTGGTAGGGCCAGACTCGTGGGCTCCGGCA
GGAGCAGGAATGGGTTCCGAATTTTTGGACCAGCTTGCAAGGCGACAGGCAGAAAGCTCTAGTGCACGTAATGGA
CCTTTTAGTCAACGCATATGGGCCGATGGTTTGCCTCCTCCTGTGGCGGAAAATGGGACGCATGCGCGACGACTA
GAAGATCTGTTCCGGCCACCATATGATCTCATGTGCCGCACCTCGTGGAACGAGGCTCGTGCGCTAGGCAAGGAA
GATAAGAAATGGATTCTGGTTAACCTCCAGGACATGAATGACTTTACTTGCCAGGCGCTGAATCGCGACATTTGG
AGAGACCAGGTGGTGCGAGAGCTGTTGTCTGAGAACTTCATCTTTCTGCAGTACGACAAGGACTACCCGGACTCG
GAGCAGTACATGACGCTTTACCTGCCGAACCAGGGCCATGAAAATGCAGACAATTTTCCACATGTGTCCATTGTG
GACCCTCGCACGGGCGAGCAGGTAAAGGTTTGGAGCGGCAGGCCCTTCCCCAGTGCCGCCGAATTCCACGCCGAC
TTGGCCGACTTTCTGGATCGGTATAGCTTGGCTGCCTACAGTAAGAACCCAGTGGCCCGAGCAGCGACACGAAAG
CCAAAACGGGTTGACGTGGAGCGCATGACGGAGGAGGAGATGTTGGAAATGGCACTCAAGAACAGCCTCGAGGGC
GACCAAGGCAGCGGGTCGCAAACACCGTCAAACATACAAGATCCCGACGAGTTGACCAAATGCGCGGGGCAGAGC
GGCGAGGGCAAGGGCAAAGAGGTGCTTGTGCAAAGCCCCTTTGAGCAGATTGCCAGCAACCAGCCACACACTGAG
CCTGAAAACGATGGGGCATCGACGCGGATCCAGTTCCGGCATCCTGCGGGAAGAGTCATTAGACGATTCCAGCTG
CAGGACCCCGTGAGGCGCATCTACGAATGGCTCAAGGCGGAGCCGCTCGAGGGCAAGGAGGGAGTCGAGTTTGAG
CTGAAGAAGATGCCTCAGGGACAGGATTTGATTGGCGCCTTGGAGGCGACAATTGAGAGCGAGGGGCTCAAGCAG
GCGACGGTCATGATTGAGTTTATCGAGTGA
Transcript >OphauG2|7031
ATGGATGACGATATCTCAACCTTCATCTCTATAACAGGCGTCAGTGCCGATATTGCCCGTGGCTTCTTGGAGCTG
ACCGGCGGCGAATTCGAGCGAGCTGTCGGTCTATACTTCGAGAACCCCGAGCTGGTACAGGCAACCGAAGAATTT
TCCCGAAGCGGCGTCCATCGGCAAGCTGTCAGCAGTTCTGGAAATATTGCATCTCGTTTAGCTCAAGTCGGAAGA
GAAGACTCTAGCGGGGTAATTCACATTAGTGACGACGAGGACATGCTGGACGATCGAGACTTTGACGACGAAGAC
GTGGAGCTAACCACGAGGCATGGAGTTGCCTCGAGGAACGAAGATGCTGCTGCTCTGCACGCTGCCAACTTGGCT
CAGGAAGAGGAAGACGCAGCCATGGCCAAACGCCTCCAGGAAGAGTTTTACGGAGCAGGCGAGGAATCTGGAGCT
GGCGCAGACGACGTAAGAGCTCCCATTGCAAGAACTACAGAGACCCTGGTAGGGCCAGACTCGTGGGCTCCGGCA
GGAGCAGGAATGGGTTCCGAATTTTTGGACCAGCTTGCAAGGCGACAGGCAGAAAGCTCTAGTGCACGTAATGGA
CCTTTTAGTCAACGCATATGGGCCGATGGTTTGCCTCCTCCTGTGGCGGAAAATGGGACGCATGCGCGACGACTA
GAAGATCTGTTCCGGCCACCATATGATCTCATGTGCCGCACCTCGTGGAACGAGGCTCGTGCGCTAGGCAAGGAA
GATAAGAAATGGATTCTGGTTAACCTCCAGGACATGAATGACTTTACTTGCCAGGCGCTGAATCGCGACATTTGG
AGAGACCAGGTGGTGCGAGAGCTGTTGTCTGAGAACTTCATCTTTCTGCAGTACGACAAGGACTACCCGGACTCG
GAGCAGTACATGACGCTTTACCTGCCGAACCAGGGCCATGAAAATGCAGACAATTTTCCACATGTGTCCATTGTG
GACCCTCGCACGGGCGAGCAGGTAAAGGTTTGGAGCGGCAGGCCCTTCCCCAGTGCCGCCGAATTCCACGCCGAC
TTGGCCGACTTTCTGGATCGGTATAGCTTGGCTGCCTACAGTAAGAACCCAGTGGCCCGAGCAGCGACACGAAAG
CCAAAACGGGTTGACGTGGAGCGCATGACGGAGGAGGAGATGTTGGAAATGGCACTCAAGAACAGCCTCGAGGGC
GACCAAGGCAGCGGGTCGCAAACACCGTCAAACATACAAGATCCCGACGAGTTGACCAAATGCGCGGGGCAGAGC
GGCGAGGGCAAGGGCAAAGAGGTGCTTGTGCAAAGCCCCTTTGAGCAGATTGCCAGCAACCAGCCACACACTGAG
CCTGAAAACGATGGGGCATCGACGCGGATCCAGTTCCGGCATCCTGCGGGAAGAGTCATTAGACGATTCCAGCTG
CAGGACCCCGTGAGGCGCATCTACGAATGGCTCAAGGCGGAGCCGCTCGAGGGCAAGGAGGGAGTCGAGTTTGAG
CTGAAGAAGATGCCTCAGGGACAGGATTTGATTGGCGCCTTGGAGGCGACAATTGAGAGCGAGGGGCTCAAGCAG
GCGACGGTCATGATTGAGTTTATCGAGTGA
Gene >OphauG2|7031
ATGGATGACGATATCTCAACCTTCATCTCTATAACAGGCGTCAGTGCCGATATTGCCCGTGGCTTCTTGGAGCTG
ACCGGCGGCGAATTCGAGCGAGCTGTCGGTCTATACTTCGAGAACCCCGAGCTGGTACAGGCAACCGAAGAATTT
TCCCGAAGCGGCGTCCATCGGCAAGCTGTCAGCAGTTCTGGAAATATTGCATCTCGTTTAGCTCAAGTCGGAAGA
GAAGACTCTAGCGGGGTAATTCACATTAGTGACGACGAGGACATGCTGGACGATCGAGACTTTGACGACGAAGAC
GTGGAGCTAACCACGAGGCATGGAGTTGCCTCGAGGAACGAAGATGCTGCTGCTCTGCACGCTGCCAACTTGGCT
CAGGAAGAGGAAGACGCAGCCATGGCCAAACGCCTCCAGGAAGAGTTTTACGGAGCAGGCGAGGAATCTGGAGCT
GGCGCAGACGACGTAAGAGCTCCCATTGCAAGAACTACAGAGACCCTGGTAGGGCCAGACTCGTGGGCTCCGGCA
GGAGCAGGAATGGGTTCCGAATTTTTGGACCAGCTTGCAAGGCGACAGGCAGAAAGCTCTAGTGGTATGTTTTCT
TGTGCTTTGGGGCACAGACTGGTCTACTCACGCGCACAATAGCACGTAATGGACCTTTTAGTCAACGCATATGGG
CCGATGGTTTGCCTCCTCCTGTGGCGGAAAATGGGACGCATGCGCGACGACTAGAAGATCTGTTCCGGCCACCAT
ATGATCTCATGTGCCGCACCTCGTGGAACGAGGCTCGTGCGCTAGGCAAGGAAGATAAGAAATGGATTCTGGTTA
ACCTCCAGGACATGAATGACTTTACTTGCCAGGCGCTGAATCGCGACATTTGGAGAGACCAGGTGGTGCGAGAGC
TGTTGTCTGAGAACTTCATCTTTCTGCAGTACGACAAGGACTACCCGGACTCGGAGCAGTACATGACGCTTTACC
TGCCGAACCAGGGCCATGAAAATGCAGACAATTTTCCACATGTGTCCATTGTGGACCCTCGCACGGGCGAGCAGG
TAAAGGTTTGGAGCGGCAGGCCCTTCCCCAGTGCCGCCGAATTCCACGCCGACTTGGCCGACTTTCTGGATCGGT
ATAGCTTGGCTGCCTACAGTAAGAACCCAGTGGCCCGAGCAGCGACACGAAAGCCAAAACGGGTTGACGTGGAGC
GCATGACGGAGGAGGAGATGTTGGAAATGGCACTCAAGAACAGCCTCGAGGGCGACCAAGGCAGCGGGTCGCAAA
CACCGTCAAACATACAAGATCCCGACGAGTTGACCAAATGCGCGGGGCAGAGCGGCGAGGGCAAGGGCAAAGAGG
TGCTTGTGCAAAGCCCCTTTGAGCAGATTGCCAGCAACCAGCCACACACTGAGCCTGAAAACGATGGGGCATCGA
CGCGGATCCAGTTCCGGCATCCTGCGGGAAGAGTCATTAGACGATTCCAGCTGCAGGACCCCGTGAGGCGCATCT
ACGAATGGCTCAAGGCGGAGCCGCTCGAGGGCAAGGAGGGAGTCGAGTTTGAGCTGAAGAAGATGCCTCAGGGAC
AGGATTTGATTGGCGCCTTGGAGGCGACAATTGAGAGCGAGGGGCTCAAGCAGGCGACGGTCATGATTGAGTTTA
TCGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail