Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7020
Gene name
LocationContig_777:7014..7977
Strand+
Gene length (bp)963
Transcript length (bp)963
Coding sequence length (bp)963
Protein length (aa) 321

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 9.7E-14 86 156

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IE79|PPIL4_GIBZE Peptidyl-prolyl cis-trans isomerase-like 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP6 PE=3 SV=2 61 234 1.0E-79
sp|Q5ARI5|PPIL4_EMENI Peptidyl-prolyl cis-trans isomerase-like 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp6 PE=3 SV=1 52 260 5.0E-72
sp|Q4WAQ9|PPIL4_ASPFU Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp6 PE=3 SV=1 31 267 3.0E-71
sp|Q2U256|PPIL4_ASPOR Peptidyl-prolyl cis-trans isomerase-like 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp6 PE=3 SV=1 31 262 1.0E-70
sp|Q871A4|PPIL4_NEUCR Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-6 PE=3 SV=1 64 226 4.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IE79|PPIL4_GIBZE Peptidyl-prolyl cis-trans isomerase-like 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP6 PE=3 SV=2 61 234 1.0E-79
sp|Q5ARI5|PPIL4_EMENI Peptidyl-prolyl cis-trans isomerase-like 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp6 PE=3 SV=1 52 260 5.0E-72
sp|Q4WAQ9|PPIL4_ASPFU Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp6 PE=3 SV=1 31 267 3.0E-71
sp|Q2U256|PPIL4_ASPOR Peptidyl-prolyl cis-trans isomerase-like 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp6 PE=3 SV=1 31 262 1.0E-70
sp|Q871A4|PPIL4_NEUCR Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-6 PE=3 SV=1 64 226 4.0E-64
sp|P0C1I6|PPIL4_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 4 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp13 PE=3 SV=1 50 215 9.0E-57
sp|Q6Q151|CYP59_ARATH Peptidyl-prolyl cis-trans isomerase CYP59 OS=Arabidopsis thaliana GN=CYP59 PE=1 SV=1 36 214 2.0E-48
sp|P0CP88|PPIL4_CRYNJ Peptidyl-prolyl cis-trans isomerase-like 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP6 PE=3 SV=1 61 175 3.0E-48
sp|P0CP89|PPIL4_CRYNB Peptidyl-prolyl cis-trans isomerase-like 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP6 PE=3 SV=1 61 175 3.0E-48
sp|P0C196|PPIL4_USTMA Peptidyl-prolyl cis-trans isomerase-like 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP6 PE=3 SV=1 65 175 8.0E-47
sp|Q8WUA2|PPIL4_HUMAN Peptidyl-prolyl cis-trans isomerase-like 4 OS=Homo sapiens GN=PPIL4 PE=1 SV=1 28 163 1.0E-46
sp|Q9UUE4|PPIL4_SCHPO Peptidyl-prolyl cis-trans isomerase cyp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp6 PE=1 SV=1 66 165 2.0E-46
sp|Q9CXG3|PPIL4_MOUSE Peptidyl-prolyl cis-trans isomerase-like 4 OS=Mus musculus GN=Ppil4 PE=1 SV=2 28 163 3.0E-46
sp|Q05AT9|U1SBP_XENLA U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Xenopus laevis GN=snrnp35 PE=2 SV=1 82 159 1.0E-11
sp|Q4KMD3|U1SBP_DANRE U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Danio rerio GN=snrnp35 PE=2 SV=1 82 171 3.0E-11
sp|Q5U1W5|U1SBP_RAT U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Rattus norvegicus GN=Snrnp35 PE=2 SV=1 82 159 6.0E-11
sp|Q9D384|U1SBP_MOUSE U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Mus musculus GN=Snrnp35 PE=2 SV=1 82 159 7.0E-11
sp|Q16560|U1SBP_HUMAN U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Homo sapiens GN=SNRNP35 PE=1 SV=1 82 159 3.0E-10
sp|Q1LZH0|U1SBP_BOVIN U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Bos taurus GN=SNRNP35 PE=2 SV=1 82 159 5.0E-10
sp|Q54Y98|TRA2_DICDI Transformer-2 protein homolog OS=Dictyostelium discoideum GN=tra2 PE=3 SV=1 77 164 9.0E-10
sp|Q60990|RBY1B_MOUSE RNA-binding motif protein, Y chromosome, family 1 member B OS=Mus musculus GN=Rbmy1b PE=2 SV=3 77 157 2.0E-08
sp|O35698|RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus GN=Rbmy1a1 PE=1 SV=2 77 157 3.0E-08
sp|Q8VY74|U1135_ARATH U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Arabidopsis thaliana GN=SNRNP35 PE=1 SV=1 82 170 2.0E-07
sp|O13829|RU17_SCHPO U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp101 PE=1 SV=1 82 158 5.0E-07
sp|Q55FQ0|RU17_DICDI U1 small nuclear ribonucleoprotein 70 kDa OS=Dictyostelium discoideum GN=snrnp70 PE=3 SV=1 75 158 5.0E-07
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 83 158 7.0E-07
sp|Q9XFD1|NCBP2_ARATH Nuclear cap-binding protein subunit 2 OS=Arabidopsis thaliana GN=CBP20 PE=1 SV=1 84 287 7.0E-07
sp|P0C8Z4|RMXL3_PANTR RNA-binding motif protein, X-linked-like-3 OS=Pan troglodytes GN=RBMXL3 PE=3 SV=1 78 186 1.0E-06
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 83 158 2.0E-06
sp|Q42404|RU17_ARATH U1 small nuclear ribonucleoprotein 70 kDa OS=Arabidopsis thaliana GN=RNU1 PE=1 SV=1 82 281 2.0E-06
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 86 161 3.0E-06
sp|Q9FMG4|SC35_ARATH Serine/arginine-rich splicing factor SC35 OS=Arabidopsis thaliana GN=SC35 PE=1 SV=1 86 161 7.0E-06
sp|Q13595|TRA2A_HUMAN Transformer-2 protein homolog alpha OS=Homo sapiens GN=TRA2A PE=1 SV=1 82 160 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7020
MASLGPSEAASSGAALDKSDKSQSINEPEPQADNGMDEESSCQAKGPCQEDLDKQLRERKAAIQAVQLELMGDLP
YAEVEPPENVLFVCKLNPVTQDEDLNLIFSRFGKIQSCEIIRDAKTKDSLQYAFIEFKEKAACEAAYFKMQDVLI
DDRRIHVDFSQSVKKLSDAWRKAANKQRRANASRGGWGGVEELEKKRQYRAHMDKREGEGYDMVHGEDKARGRDQ
GVPEDAPREARSLRRRRRDSDDAGYARNRSRSPQRRERTTDRYSSSRRDGHGRRRETDLDMRSRDQQHYKRDGNQ
RGDAGRYHDRHSDSYHRSRR*
Coding >OphauG2|7020
ATGGCATCTCTTGGCCCGTCTGAGGCTGCATCTTCTGGCGCGGCTTTGGACAAGTCGGATAAGAGCCAAAGCATC
AATGAGCCTGAGCCACAGGCAGACAATGGCATGGACGAAGAATCATCATGTCAAGCCAAAGGCCCCTGCCAAGAG
GATCTTGACAAGCAACTTCGCGAGCGGAAAGCTGCAATCCAAGCCGTCCAGCTCGAGCTCATGGGCGACCTGCCT
TATGCCGAAGTCGAGCCACCAGAAAACGTTCTCTTCGTCTGCAAGCTCAACCCCGTGACGCAAGACGAAGACCTA
AATCTCATCTTTAGCCGATTTGGAAAGATTCAAAGTTGCGAGATAATACGGGATGCAAAGACAAAGGACAGTTTG
CAGTATGCTTTTATCGAGTTTAAAGAGAAAGCGGCATGCGAGGCTGCATACTTCAAGATGCAAGACGTCTTGATT
GATGATCGGCGGATCCACGTTGATTTCTCACAGAGCGTCAAGAAGCTGAGTGACGCGTGGAGAAAAGCTGCCAAC
AAGCAACGCAGAGCCAATGCTTCCAGAGGAGGTTGGGGGGGAGTTGAAGAATTGGAGAAGAAGAGGCAGTACAGG
GCGCATATGGACAAGAGGGAGGGCGAGGGGTACGATATGGTCCACGGCGAGGACAAGGCGAGAGGACGTGATCAA
GGGGTGCCAGAGGATGCGCCAAGAGAGGCCAGATCCTTGAGGAGACGCCGACGGGACTCGGACGATGCCGGATAT
GCCCGTAATCGTAGCCGAAGCCCCCAGCGACGCGAGAGGACCACGGACAGATATTCATCAAGTCGAAGAGATGGT
CATGGACGCCGCAGAGAAACAGATTTGGATATGAGGAGTCGTGACCAACAACACTACAAACGAGACGGAAACCAG
CGTGGGGATGCAGGCCGCTATCATGATAGGCACTCGGACAGCTACCACCGATCACGACGGTGA
Transcript >OphauG2|7020
ATGGCATCTCTTGGCCCGTCTGAGGCTGCATCTTCTGGCGCGGCTTTGGACAAGTCGGATAAGAGCCAAAGCATC
AATGAGCCTGAGCCACAGGCAGACAATGGCATGGACGAAGAATCATCATGTCAAGCCAAAGGCCCCTGCCAAGAG
GATCTTGACAAGCAACTTCGCGAGCGGAAAGCTGCAATCCAAGCCGTCCAGCTCGAGCTCATGGGCGACCTGCCT
TATGCCGAAGTCGAGCCACCAGAAAACGTTCTCTTCGTCTGCAAGCTCAACCCCGTGACGCAAGACGAAGACCTA
AATCTCATCTTTAGCCGATTTGGAAAGATTCAAAGTTGCGAGATAATACGGGATGCAAAGACAAAGGACAGTTTG
CAGTATGCTTTTATCGAGTTTAAAGAGAAAGCGGCATGCGAGGCTGCATACTTCAAGATGCAAGACGTCTTGATT
GATGATCGGCGGATCCACGTTGATTTCTCACAGAGCGTCAAGAAGCTGAGTGACGCGTGGAGAAAAGCTGCCAAC
AAGCAACGCAGAGCCAATGCTTCCAGAGGAGGTTGGGGGGGAGTTGAAGAATTGGAGAAGAAGAGGCAGTACAGG
GCGCATATGGACAAGAGGGAGGGCGAGGGGTACGATATGGTCCACGGCGAGGACAAGGCGAGAGGACGTGATCAA
GGGGTGCCAGAGGATGCGCCAAGAGAGGCCAGATCCTTGAGGAGACGCCGACGGGACTCGGACGATGCCGGATAT
GCCCGTAATCGTAGCCGAAGCCCCCAGCGACGCGAGAGGACCACGGACAGATATTCATCAAGTCGAAGAGATGGT
CATGGACGCCGCAGAGAAACAGATTTGGATATGAGGAGTCGTGACCAACAACACTACAAACGAGACGGAAACCAG
CGTGGGGATGCAGGCCGCTATCATGATAGGCACTCGGACAGCTACCACCGATCACGACGGTGA
Gene >OphauG2|7020
ATGGCATCTCTTGGCCCGTCTGAGGCTGCATCTTCTGGCGCGGCTTTGGACAAGTCGGATAAGAGCCAAAGCATC
AATGAGCCTGAGCCACAGGCAGACAATGGCATGGACGAAGAATCATCATGTCAAGCCAAAGGCCCCTGCCAAGAG
GATCTTGACAAGCAACTTCGCGAGCGGAAAGCTGCAATCCAAGCCGTCCAGCTCGAGCTCATGGGCGACCTGCCT
TATGCCGAAGTCGAGCCACCAGAAAACGTTCTCTTCGTCTGCAAGCTCAACCCCGTGACGCAAGACGAAGACCTA
AATCTCATCTTTAGCCGATTTGGAAAGATTCAAAGTTGCGAGATAATACGGGATGCAAAGACAAAGGACAGTTTG
CAGTATGCTTTTATCGAGTTTAAAGAGAAAGCGGCATGCGAGGCTGCATACTTCAAGATGCAAGACGTCTTGATT
GATGATCGGCGGATCCACGTTGATTTCTCACAGAGCGTCAAGAAGCTGAGTGACGCGTGGAGAAAAGCTGCCAAC
AAGCAACGCAGAGCCAATGCTTCCAGAGGAGGTTGGGGGGGAGTTGAAGAATTGGAGAAGAAGAGGCAGTACAGG
GCGCATATGGACAAGAGGGAGGGCGAGGGGTACGATATGGTCCACGGCGAGGACAAGGCGAGAGGACGTGATCAA
GGGGTGCCAGAGGATGCGCCAAGAGAGGCCAGATCCTTGAGGAGACGCCGACGGGACTCGGACGATGCCGGATAT
GCCCGTAATCGTAGCCGAAGCCCCCAGCGACGCGAGAGGACCACGGACAGATATTCATCAAGTCGAAGAGATGGT
CATGGACGCCGCAGAGAAACAGATTTGGATATGAGGAGTCGTGACCAACAACACTACAAACGAGACGGAAACCAG
CGTGGGGATGCAGGCCGCTATCATGATAGGCACTCGGACAGCTACCACCGATCACGACGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail