Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7012
Gene name
LocationContig_775:3598..5457
Strand+
Gene length (bp)1859
Transcript length (bp)1800
Coding sequence length (bp)1800
Protein length (aa) 600

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12735 Trs65 TRAPP trafficking subunit Trs65 5.4E-107 287 595

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0006891 intra-Golgi vesicle-mediated transport Yes
GO:1990071 TRAPPII protein complex Yes
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0006810 transport No
GO:0032991 protein-containing complex No
GO:0030008 TRAPP complex No
GO:0008150 biological_process No
GO:0099023 vesicle tethering complex No
GO:0140535 intracellular protein-containing complex No
GO:0005575 cellular_component No
GO:0048193 Golgi vesicle transport No
GO:0016192 vesicle-mediated transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7012
MSGHGSVPAEDLTAASAVAPSPSLCDESYLAYLVPADSHLDLEHLFANSQAGKAVLDSIAQRQALFFDETVDVLL
MLKLPWLEERELQAHVSRLLISLQAQIVNANASGRDSATPSSETIFTGHVEEVGDPLVIVHQEETGPGESDTSQH
VYAIWKLPVFLARPRMRPLNPSVVLTASASLRGEPAAGVAARGSGYLASGLPASANLLQSFVHDAQLAGASPPHL
SALRVSRVTPLTGHQEAASRLRALPQLKLPIFPVIHTRVRFSRPNVAPASATIVSLLEVDLTAHFECEVLLDKVS
LLSPDASVESLDQAPMKLPLACHAHDHISFLHVIKPTQSPDRPRPVSSTLDISLSAVVKVSPAVCEPRLSIKWST
ALDFTTPVNPSFAPSETGIRRPRRPSQLSIGSATAETPLRSQGSMQPDALPALEASATRSEAAIPDLGITMSFTR
PCTPIYPGDVFSWTVYVVNRSSDRSGRPARKLALVAMAKRRRNELRPLRPPSTATRRRGDKEVADAVLDDNVLHA
MHKSSLVDAADVICLSADARVGPLGPGACHVTELQFLALRQGIVDIEAVRVIDLNTQEHVDIRDLPTVMIEPVP*
Coding >OphauG2|7012
ATGTCGGGCCATGGCTCCGTCCCTGCCGAGGACCTGACGGCTGCAAGCGCCGTGGCGCCGAGCCCAAGCCTGTGC
GACGAGTCCTATCTGGCATATCTGGTCCCCGCCGACTCGCATCTCGACCTCGAGCACCTCTTTGCAAACTCGCAG
GCTGGCAAGGCGGTGCTGGATTCAATAGCCCAGCGTCAGGCGCTTTTCTTTGATGAAACCGTCGACGTCTTGCTC
ATGCTCAAGCTGCCGTGGCTCGAGGAGCGGGAGCTTCAGGCCCATGTGTCTCGCCTCTTGATTTCGCTGCAGGCC
CAGATTGTCAATGCCAATGCTTCCGGCCGTGACTCTGCAACGCCAAGCTCTGAGACGATATTCACCGGCCATGTG
GAGGAGGTTGGTGACCCCTTGGTCATAGTCCACCAGGAGGAGACTGGCCCTGGCGAGTCGGACACGTCGCAGCAT
GTCTATGCCATCTGGAAACTGCCCGTCTTCCTCGCCCGCCCGCGCATGCGACCCCTTAATCCTTCTGTCGTCTTG
ACTGCTTCGGCCAGTCTCCGTGGCGAGCCTGCTGCTGGCGTTGCCGCCCGCGGCTCAGGCTATCTTGCCAGTGGC
CTTCCAGCCAGCGCCAACTTGCTTCAGTCTTTTGTCCACGACGCGCAACTCGCCGGCGCCAGCCCCCCCCATCTC
TCTGCCCTTCGCGTTTCCAGGGTTACTCCCTTGACGGGGCATCAAGAGGCGGCGTCTCGTCTGCGTGCTCTGCCC
CAGCTCAAGCTTCCCATCTTCCCCGTTATTCACACCAGGGTGCGCTTTTCGCGGCCCAACGTCGCCCCGGCCAGT
GCCACCATTGTGTCGCTTCTTGAAGTCGACCTGACGGCGCATTTTGAGTGTGAAGTGCTGCTGGATAAAGTCTCC
CTCTTGTCGCCAGACGCCAGCGTCGAGAGCCTCGATCAGGCCCCCATGAAGCTCCCCCTCGCCTGCCACGCTCAC
GACCACATTTCATTTCTCCACGTCATCAAGCCCACTCAGTCGCCGGACCGTCCGCGCCCCGTCAGCAGTACCCTC
GACATCTCCCTCTCGGCCGTGGTCAAAGTGTCACCCGCCGTCTGCGAGCCTCGGTTGTCCATAAAATGGAGCACG
GCGCTCGACTTCACCACGCCCGTTAACCCCAGCTTCGCGCCCTCAGAGACGGGCATTCGCCGGCCTCGTCGCCCC
TCCCAACTCTCCATTGGCAGCGCCACTGCCGAGACGCCTCTCCGTTCCCAGGGCTCGATGCAGCCCGACGCACTG
CCTGCCCTCGAAGCCTCTGCCACTCGCTCCGAAGCCGCGATTCCCGACCTCGGCATCACCATGTCCTTTACCCGT
CCTTGCACCCCCATTTATCCCGGCGACGTCTTCTCTTGGACCGTCTATGTAGTCAATCGCTCCAGCGACCGTTCT
GGCCGACCGGCCCGTAAGCTCGCTCTCGTAGCCATGGCCAAGCGCCGCCGTAACGAGCTTCGTCCGCTTCGCCCG
CCCTCGACTGCTACGCGCCGCCGCGGAGACAAGGAGGTGGCTGACGCCGTCCTCGATGACAATGTCCTGCACGCC
ATGCACAAGAGCTCTCTTGTCGATGCCGCCGACGTCATCTGCCTCAGCGCTGATGCTCGGGTTGGCCCCCTGGGC
CCGGGCGCCTGCCACGTAACTGAGCTGCAATTTCTGGCTTTGCGGCAGGGCATCGTCGACATTGAAGCCGTGCGA
GTCATTGACTTGAATACCCAGGAACATGTCGACATACGAGACTTGCCAACCGTCATGATTGAGCCTGTTCCTTGA
Transcript >OphauG2|7012
ATGTCGGGCCATGGCTCCGTCCCTGCCGAGGACCTGACGGCTGCAAGCGCCGTGGCGCCGAGCCCAAGCCTGTGC
GACGAGTCCTATCTGGCATATCTGGTCCCCGCCGACTCGCATCTCGACCTCGAGCACCTCTTTGCAAACTCGCAG
GCTGGCAAGGCGGTGCTGGATTCAATAGCCCAGCGTCAGGCGCTTTTCTTTGATGAAACCGTCGACGTCTTGCTC
ATGCTCAAGCTGCCGTGGCTCGAGGAGCGGGAGCTTCAGGCCCATGTGTCTCGCCTCTTGATTTCGCTGCAGGCC
CAGATTGTCAATGCCAATGCTTCCGGCCGTGACTCTGCAACGCCAAGCTCTGAGACGATATTCACCGGCCATGTG
GAGGAGGTTGGTGACCCCTTGGTCATAGTCCACCAGGAGGAGACTGGCCCTGGCGAGTCGGACACGTCGCAGCAT
GTCTATGCCATCTGGAAACTGCCCGTCTTCCTCGCCCGCCCGCGCATGCGACCCCTTAATCCTTCTGTCGTCTTG
ACTGCTTCGGCCAGTCTCCGTGGCGAGCCTGCTGCTGGCGTTGCCGCCCGCGGCTCAGGCTATCTTGCCAGTGGC
CTTCCAGCCAGCGCCAACTTGCTTCAGTCTTTTGTCCACGACGCGCAACTCGCCGGCGCCAGCCCCCCCCATCTC
TCTGCCCTTCGCGTTTCCAGGGTTACTCCCTTGACGGGGCATCAAGAGGCGGCGTCTCGTCTGCGTGCTCTGCCC
CAGCTCAAGCTTCCCATCTTCCCCGTTATTCACACCAGGGTGCGCTTTTCGCGGCCCAACGTCGCCCCGGCCAGT
GCCACCATTGTGTCGCTTCTTGAAGTCGACCTGACGGCGCATTTTGAGTGTGAAGTGCTGCTGGATAAAGTCTCC
CTCTTGTCGCCAGACGCCAGCGTCGAGAGCCTCGATCAGGCCCCCATGAAGCTCCCCCTCGCCTGCCACGCTCAC
GACCACATTTCATTTCTCCACGTCATCAAGCCCACTCAGTCGCCGGACCGTCCGCGCCCCGTCAGCAGTACCCTC
GACATCTCCCTCTCGGCCGTGGTCAAAGTGTCACCCGCCGTCTGCGAGCCTCGGTTGTCCATAAAATGGAGCACG
GCGCTCGACTTCACCACGCCCGTTAACCCCAGCTTCGCGCCCTCAGAGACGGGCATTCGCCGGCCTCGTCGCCCC
TCCCAACTCTCCATTGGCAGCGCCACTGCCGAGACGCCTCTCCGTTCCCAGGGCTCGATGCAGCCCGACGCACTG
CCTGCCCTCGAAGCCTCTGCCACTCGCTCCGAAGCCGCGATTCCCGACCTCGGCATCACCATGTCCTTTACCCGT
CCTTGCACCCCCATTTATCCCGGCGACGTCTTCTCTTGGACCGTCTATGTAGTCAATCGCTCCAGCGACCGTTCT
GGCCGACCGGCCCGTAAGCTCGCTCTCGTAGCCATGGCCAAGCGCCGCCGTAACGAGCTTCGTCCGCTTCGCCCG
CCCTCGACTGCTACGCGCCGCCGCGGAGACAAGGAGGTGGCTGACGCCGTCCTCGATGACAATGTCCTGCACGCC
ATGCACAAGAGCTCTCTTGTCGATGCCGCCGACGTCATCTGCCTCAGCGCTGATGCTCGGGTTGGCCCCCTGGGC
CCGGGCGCCTGCCACGTAACTGAGCTGCAATTTCTGGCTTTGCGGCAGGGCATCGTCGACATTGAAGCCGTGCGA
GTCATTGACTTGAATACCCAGGAACATGTCGACATACGAGACTTGCCAACCGTCATGATTGAGCCTGTTCCTTGA
Gene >OphauG2|7012
ATGTCGGGCCATGGCTCCGTCCCTGCCGAGGACCTGACGGCTGCAAGCGCCGTGGCGCCGAGCCCAAGCCTGTGC
GACGAGTCCTATCTGGCATATCTGGTCCCCGCCGACTCGCATCTCGACCTCGAGCACCTCTTTGCAAACTCGCAG
GCTGGCAAGGCGGTGCTGGATTCAATAGCCCAGCGTCAGGCGCTTTTCTTTGGTACAACCGTCCCAACTCGTGCC
GCCTTGCATTGCCTTGAGCTGACGGCGTGCTCGCAGATGAAACCGTCGACGTCTTGCTCATGCTCAAGCTGCCGT
GGCTCGAGGAGCGGGAGCTTCAGGCCCATGTGTCTCGCCTCTTGATTTCGCTGCAGGCCCAGATTGTCAATGCCA
ATGCTTCCGGCCGTGACTCTGCAACGCCAAGCTCTGAGACGATATTCACCGGCCATGTGGAGGAGGTTGGTGACC
CCTTGGTCATAGTCCACCAGGAGGAGACTGGCCCTGGCGAGTCGGACACGTCGCAGCATGTCTATGCCATCTGGA
AACTGCCCGTCTTCCTCGCCCGCCCGCGCATGCGACCCCTTAATCCTTCTGTCGTCTTGACTGCTTCGGCCAGTC
TCCGTGGCGAGCCTGCTGCTGGCGTTGCCGCCCGCGGCTCAGGCTATCTTGCCAGTGGCCTTCCAGCCAGCGCCA
ACTTGCTTCAGTCTTTTGTCCACGACGCGCAACTCGCCGGCGCCAGCCCCCCCCATCTCTCTGCCCTTCGCGTTT
CCAGGGTTACTCCCTTGACGGGGCATCAAGAGGCGGCGTCTCGTCTGCGTGCTCTGCCCCAGCTCAAGCTTCCCA
TCTTCCCCGTTATTCACACCAGGGTGCGCTTTTCGCGGCCCAACGTCGCCCCGGCCAGTGCCACCATTGTGTCGC
TTCTTGAAGTCGACCTGACGGCGCATTTTGAGTGTGAAGTGCTGCTGGATAAAGTCTCCCTCTTGTCGCCAGACG
CCAGCGTCGAGAGCCTCGATCAGGCCCCCATGAAGCTCCCCCTCGCCTGCCACGCTCACGACCACATTTCATTTC
TCCACGTCATCAAGCCCACTCAGTCGCCGGACCGTCCGCGCCCCGTCAGCAGTACCCTCGACATCTCCCTCTCGG
CCGTGGTCAAAGTGTCACCCGCCGTCTGCGAGCCTCGGTTGTCCATAAAATGGAGCACGGCGCTCGACTTCACCA
CGCCCGTTAACCCCAGCTTCGCGCCCTCAGAGACGGGCATTCGCCGGCCTCGTCGCCCCTCCCAACTCTCCATTG
GCAGCGCCACTGCCGAGACGCCTCTCCGTTCCCAGGGCTCGATGCAGCCCGACGCACTGCCTGCCCTCGAAGCCT
CTGCCACTCGCTCCGAAGCCGCGATTCCCGACCTCGGCATCACCATGTCCTTTACCCGTCCTTGCACCCCCATTT
ATCCCGGCGACGTCTTCTCTTGGACCGTCTATGTAGTCAATCGCTCCAGCGACCGTTCTGGCCGACCGGCCCGTA
AGCTCGCTCTCGTAGCCATGGCCAAGCGCCGCCGTAACGAGCTTCGTCCGCTTCGCCCGCCCTCGACTGCTACGC
GCCGCCGCGGAGACAAGGAGGTGGCTGACGCCGTCCTCGATGACAATGTCCTGCACGCCATGCACAAGAGCTCTC
TTGTCGATGCCGCCGACGTCATCTGCCTCAGCGCTGATGCTCGGGTTGGCCCCCTGGGCCCGGGCGCCTGCCACG
TAACTGAGCTGCAATTTCTGGCTTTGCGGCAGGGCATCGTCGACATTGAAGCCGTGCGAGTCATTGACTTGAATA
CCCAGGAACATGTCGACATACGAGACTTGCCAACCGTCATGATTGAGCCTGTTCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail