Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7010
Gene name
LocationContig_774:6248..8225
Strand+
Gene length (bp)1977
Transcript length (bp)1977
Coding sequence length (bp)1977
Protein length (aa) 659

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03074 GCS Glutamate-cysteine ligase 3.4E-176 198 587

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X0X0|GSH1_NEUCR Glutamate--cysteine ligase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gcs-1 PE=3 SV=1 2 619 0.0E+00
sp|Q09768|GSH1_SCHPO Glutamate--cysteine ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcs1 PE=3 SV=1 11 589 0.0E+00
sp|P97494|GSH1_MOUSE Glutamate--cysteine ligase catalytic subunit OS=Mus musculus GN=Gclc PE=1 SV=4 47 606 5.0E-179
sp|P19468|GSH1_RAT Glutamate--cysteine ligase catalytic subunit OS=Rattus norvegicus GN=Gclc PE=1 SV=2 47 606 4.0E-178
sp|P48506|GSH1_HUMAN Glutamate--cysteine ligase catalytic subunit OS=Homo sapiens GN=GCLC PE=1 SV=2 9 606 1.0E-177
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X0X0|GSH1_NEUCR Glutamate--cysteine ligase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gcs-1 PE=3 SV=1 2 619 0.0E+00
sp|Q09768|GSH1_SCHPO Glutamate--cysteine ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcs1 PE=3 SV=1 11 589 0.0E+00
sp|P97494|GSH1_MOUSE Glutamate--cysteine ligase catalytic subunit OS=Mus musculus GN=Gclc PE=1 SV=4 47 606 5.0E-179
sp|P19468|GSH1_RAT Glutamate--cysteine ligase catalytic subunit OS=Rattus norvegicus GN=Gclc PE=1 SV=2 47 606 4.0E-178
sp|P48506|GSH1_HUMAN Glutamate--cysteine ligase catalytic subunit OS=Homo sapiens GN=GCLC PE=1 SV=2 9 606 1.0E-177
sp|Q54PC2|GSH1_DICDI Glutamate--cysteine ligase OS=Dictyostelium discoideum GN=gcsA PE=2 SV=1 11 590 3.0E-164
sp|Q20117|GSH1_CAEEL Glutamate--cysteine ligase OS=Caenorhabditis elegans GN=gcs-1 PE=1 SV=2 6 645 4.0E-160
sp|Q9NFN6|GSH1_ONCVO Glutamate--cysteine ligase OS=Onchocerca volvulus GN=gcs-1 PE=2 SV=2 2 591 1.0E-153
sp|Q9W3K5|GSH1_DROME Glutamate--cysteine ligase OS=Drosophila melanogaster GN=Gclc PE=2 SV=1 20 454 4.0E-126
sp|Q9HF78|GSH1_CANAX Glutamate--cysteine ligase OS=Candida albicans GN=GCS1 PE=3 SV=1 9 452 2.0E-118
sp|P32477|GSH1_YEAST Glutamate--cysteine ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSH1 PE=1 SV=1 48 586 3.0E-117
sp|Q9W3K5|GSH1_DROME Glutamate--cysteine ligase OS=Drosophila melanogaster GN=Gclc PE=2 SV=1 498 591 3.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0004357 glutamate-cysteine ligase activity Yes
GO:0006750 glutathione biosynthetic process Yes
GO:0006790 sulfur compound metabolic process No
GO:0044272 sulfur compound biosynthetic process No
GO:0016881 acid-amino acid ligase activity No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0043603 cellular amide metabolic process No
GO:0016874 ligase activity No
GO:0006749 glutathione metabolic process No
GO:0009987 cellular process No
GO:0019184 nonribosomal peptide biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043604 amide biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0006575 cellular modified amino acid metabolic process No
GO:0042398 cellular modified amino acid biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0043043 peptide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7010
MYSKDDTKVLVSLRQAEILTALDADKDLNRVSEHSNGTPDKSSSLPVFHPEFGRFMLEATPGKPWGIGFKELLDV
EPDMKLRRKIAKEHMLSNEYPITLTTFPRLGCQGQFTHPSYPPSGPKLRSQFVPDEIANPHIRFPTLAANIRHRR
GRKVQVNVPVFHDEKTSSPWKDPTVNYDLHNWPEDDDVRNGAAPDDHIHMDAMAFGMGSCCLQITFQAKNINEGR
QLYDQLSPLGPIMLALTAATPIYKGFLAKTDVRWNQISRAVDCRTPEELGEKPLKNDRWRIPKSRYASNSTYIST
DSRLRREYLDPDLVIDEEIKASLVKGGMDDLLATHFAHLFIRDPIVVFEEDLLELDLGKTDHFENIQSTNWQHMR
FKPPPAENNIGWRVEFRSMEIQITDFENAAFSVFMVLITRAILSFDLNFYIPIKRVDENMERAHALDAVLNQKFF
FRKNPFPPRASRANTAFGGGEESRPGSAMPSRPGSPPPGPVEDEYCEMSIDEIVNGSAEGDFPGLIPIVESYLDS
VNVDVETRCRLSTYLDLIGRRACGRLDTAARWIRNFVQSHPRYGRDSVVDDEIVHDLVGAVIAVGEREARGQGFA
RLGINGLHRLLGPFRGGCGQPETDQDSNGAVANEAVEPGSPSRKRKSEWIDGEAVRVE*
Coding >OphauG2|7010
ATGTACTCCAAGGACGACACCAAAGTTCTTGTGTCTCTGCGCCAGGCTGAGATTCTGACGGCTCTAGACGCGGAC
AAGGACTTGAATCGTGTTTCGGAACACAGCAACGGAACACCTGACAAGTCGAGTTCGCTGCCAGTATTTCACCCC
GAGTTTGGCCGCTTCATGCTCGAGGCGACCCCGGGCAAACCATGGGGCATTGGCTTCAAGGAGCTTCTTGACGTT
GAGCCTGATATGAAGCTCCGGCGTAAGATTGCCAAGGAGCACATGTTGTCCAATGAGTATCCCATTACCCTGACG
ACATTTCCTCGCTTGGGGTGCCAAGGACAATTCACCCACCCCTCCTATCCGCCATCTGGGCCCAAACTGCGCTCT
CAGTTTGTGCCTGACGAAATTGCCAACCCCCATATTCGCTTCCCTACATTGGCTGCCAATATACGCCATCGGCGC
GGCCGCAAGGTTCAAGTCAATGTGCCCGTCTTTCACGATGAAAAGACATCGAGTCCGTGGAAGGATCCAACAGTC
AACTACGATTTGCACAACTGGCCCGAGGATGACGATGTGCGCAACGGCGCGGCCCCAGACGACCATATACACATG
GACGCCATGGCTTTTGGCATGGGAAGCTGTTGCCTGCAGATTACTTTTCAGGCCAAGAATATAAACGAGGGAAGA
CAGCTGTACGATCAGCTGAGCCCTCTTGGACCTATTATGCTGGCTCTCACGGCGGCCACACCCATCTACAAGGGC
TTCCTGGCCAAGACGGATGTGCGGTGGAACCAAATTAGCCGCGCTGTAGACTGCAGAACGCCGGAGGAACTAGGG
GAAAAGCCTCTCAAAAACGATCGATGGCGCATCCCCAAGTCGAGGTATGCCTCAAACTCGACGTACATCTCTACC
GACTCGAGACTGCGACGGGAATACCTCGACCCAGACCTGGTGATTGACGAGGAAATCAAGGCCAGTCTGGTAAAA
GGCGGCATGGACGACCTGCTGGCGACTCACTTTGCCCACCTCTTCATCCGTGACCCCATTGTTGTCTTTGAGGAG
GACTTGTTGGAGCTAGACTTGGGCAAAACGGATCATTTTGAGAATATACAGTCAACCAATTGGCAGCACATGCGC
TTCAAACCGCCGCCGGCCGAGAACAATATTGGCTGGCGAGTCGAGTTCCGGTCAATGGAGATTCAAATCACAGAC
TTTGAGAATGCGGCCTTTTCAGTCTTCATGGTGCTCATTACCCGGGCCATTTTGTCCTTTGATCTCAATTTCTAC
ATACCCATCAAGAGGGTGGACGAGAATATGGAAAGGGCACACGCACTCGATGCTGTACTCAATCAAAAGTTTTTC
TTTCGCAAGAATCCCTTCCCGCCTCGAGCGTCGCGTGCCAATACGGCATTTGGGGGCGGAGAAGAGTCGCGGCCC
GGCTCTGCCATGCCTAGCAGGCCTGGATCGCCGCCGCCGGGCCCCGTAGAGGACGAGTACTGCGAAATGTCGATT
GACGAGATTGTAAATGGCAGCGCCGAGGGCGATTTCCCCGGGCTCATTCCCATTGTGGAGAGCTACCTGGACAGC
GTCAATGTCGACGTGGAGACGCGCTGCCGCCTATCGACATATCTCGATTTGATTGGGCGCCGTGCTTGTGGCCGG
CTGGATACGGCGGCGCGGTGGATCCGCAACTTTGTACAGTCGCACCCACGGTACGGGCGCGACAGCGTCGTCGAT
GACGAGATTGTGCACGACCTAGTGGGTGCCGTTATTGCCGTTGGCGAGCGCGAGGCCCGGGGCCAGGGGTTTGCC
CGTCTTGGAATTAACGGGCTTCATCGGTTGCTGGGACCATTTCGCGGCGGATGTGGCCAGCCTGAGACAGACCAG
GACAGCAACGGCGCCGTGGCAAACGAGGCAGTCGAGCCCGGGTCGCCGTCGCGGAAACGCAAAAGCGAATGGATC
GACGGCGAGGCGGTCAGGGTGGAGTGA
Transcript >OphauG2|7010
ATGTACTCCAAGGACGACACCAAAGTTCTTGTGTCTCTGCGCCAGGCTGAGATTCTGACGGCTCTAGACGCGGAC
AAGGACTTGAATCGTGTTTCGGAACACAGCAACGGAACACCTGACAAGTCGAGTTCGCTGCCAGTATTTCACCCC
GAGTTTGGCCGCTTCATGCTCGAGGCGACCCCGGGCAAACCATGGGGCATTGGCTTCAAGGAGCTTCTTGACGTT
GAGCCTGATATGAAGCTCCGGCGTAAGATTGCCAAGGAGCACATGTTGTCCAATGAGTATCCCATTACCCTGACG
ACATTTCCTCGCTTGGGGTGCCAAGGACAATTCACCCACCCCTCCTATCCGCCATCTGGGCCCAAACTGCGCTCT
CAGTTTGTGCCTGACGAAATTGCCAACCCCCATATTCGCTTCCCTACATTGGCTGCCAATATACGCCATCGGCGC
GGCCGCAAGGTTCAAGTCAATGTGCCCGTCTTTCACGATGAAAAGACATCGAGTCCGTGGAAGGATCCAACAGTC
AACTACGATTTGCACAACTGGCCCGAGGATGACGATGTGCGCAACGGCGCGGCCCCAGACGACCATATACACATG
GACGCCATGGCTTTTGGCATGGGAAGCTGTTGCCTGCAGATTACTTTTCAGGCCAAGAATATAAACGAGGGAAGA
CAGCTGTACGATCAGCTGAGCCCTCTTGGACCTATTATGCTGGCTCTCACGGCGGCCACACCCATCTACAAGGGC
TTCCTGGCCAAGACGGATGTGCGGTGGAACCAAATTAGCCGCGCTGTAGACTGCAGAACGCCGGAGGAACTAGGG
GAAAAGCCTCTCAAAAACGATCGATGGCGCATCCCCAAGTCGAGGTATGCCTCAAACTCGACGTACATCTCTACC
GACTCGAGACTGCGACGGGAATACCTCGACCCAGACCTGGTGATTGACGAGGAAATCAAGGCCAGTCTGGTAAAA
GGCGGCATGGACGACCTGCTGGCGACTCACTTTGCCCACCTCTTCATCCGTGACCCCATTGTTGTCTTTGAGGAG
GACTTGTTGGAGCTAGACTTGGGCAAAACGGATCATTTTGAGAATATACAGTCAACCAATTGGCAGCACATGCGC
TTCAAACCGCCGCCGGCCGAGAACAATATTGGCTGGCGAGTCGAGTTCCGGTCAATGGAGATTCAAATCACAGAC
TTTGAGAATGCGGCCTTTTCAGTCTTCATGGTGCTCATTACCCGGGCCATTTTGTCCTTTGATCTCAATTTCTAC
ATACCCATCAAGAGGGTGGACGAGAATATGGAAAGGGCACACGCACTCGATGCTGTACTCAATCAAAAGTTTTTC
TTTCGCAAGAATCCCTTCCCGCCTCGAGCGTCGCGTGCCAATACGGCATTTGGGGGCGGAGAAGAGTCGCGGCCC
GGCTCTGCCATGCCTAGCAGGCCTGGATCGCCGCCGCCGGGCCCCGTAGAGGACGAGTACTGCGAAATGTCGATT
GACGAGATTGTAAATGGCAGCGCCGAGGGCGATTTCCCCGGGCTCATTCCCATTGTGGAGAGCTACCTGGACAGC
GTCAATGTCGACGTGGAGACGCGCTGCCGCCTATCGACATATCTCGATTTGATTGGGCGCCGTGCTTGTGGCCGG
CTGGATACGGCGGCGCGGTGGATCCGCAACTTTGTACAGTCGCACCCACGGTACGGGCGCGACAGCGTCGTCGAT
GACGAGATTGTGCACGACCTAGTGGGTGCCGTTATTGCCGTTGGCGAGCGCGAGGCCCGGGGCCAGGGGTTTGCC
CGTCTTGGAATTAACGGGCTTCATCGGTTGCTGGGACCATTTCGCGGCGGATGTGGCCAGCCTGAGACAGACCAG
GACAGCAACGGCGCCGTGGCAAACGAGGCAGTCGAGCCCGGGTCGCCGTCGCGGAAACGCAAAAGCGAATGGATC
GACGGCGAGGCGGTCAGGGTGGAGTGA
Gene >OphauG2|7010
ATGTACTCCAAGGACGACACCAAAGTTCTTGTGTCTCTGCGCCAGGCTGAGATTCTGACGGCTCTAGACGCGGAC
AAGGACTTGAATCGTGTTTCGGAACACAGCAACGGAACACCTGACAAGTCGAGTTCGCTGCCAGTATTTCACCCC
GAGTTTGGCCGCTTCATGCTCGAGGCGACCCCGGGCAAACCATGGGGCATTGGCTTCAAGGAGCTTCTTGACGTT
GAGCCTGATATGAAGCTCCGGCGTAAGATTGCCAAGGAGCACATGTTGTCCAATGAGTATCCCATTACCCTGACG
ACATTTCCTCGCTTGGGGTGCCAAGGACAATTCACCCACCCCTCCTATCCGCCATCTGGGCCCAAACTGCGCTCT
CAGTTTGTGCCTGACGAAATTGCCAACCCCCATATTCGCTTCCCTACATTGGCTGCCAATATACGCCATCGGCGC
GGCCGCAAGGTTCAAGTCAATGTGCCCGTCTTTCACGATGAAAAGACATCGAGTCCGTGGAAGGATCCAACAGTC
AACTACGATTTGCACAACTGGCCCGAGGATGACGATGTGCGCAACGGCGCGGCCCCAGACGACCATATACACATG
GACGCCATGGCTTTTGGCATGGGAAGCTGTTGCCTGCAGATTACTTTTCAGGCCAAGAATATAAACGAGGGAAGA
CAGCTGTACGATCAGCTGAGCCCTCTTGGACCTATTATGCTGGCTCTCACGGCGGCCACACCCATCTACAAGGGC
TTCCTGGCCAAGACGGATGTGCGGTGGAACCAAATTAGCCGCGCTGTAGACTGCAGAACGCCGGAGGAACTAGGG
GAAAAGCCTCTCAAAAACGATCGATGGCGCATCCCCAAGTCGAGGTATGCCTCAAACTCGACGTACATCTCTACC
GACTCGAGACTGCGACGGGAATACCTCGACCCAGACCTGGTGATTGACGAGGAAATCAAGGCCAGTCTGGTAAAA
GGCGGCATGGACGACCTGCTGGCGACTCACTTTGCCCACCTCTTCATCCGTGACCCCATTGTTGTCTTTGAGGAG
GACTTGTTGGAGCTAGACTTGGGCAAAACGGATCATTTTGAGAATATACAGTCAACCAATTGGCAGCACATGCGC
TTCAAACCGCCGCCGGCCGAGAACAATATTGGCTGGCGAGTCGAGTTCCGGTCAATGGAGATTCAAATCACAGAC
TTTGAGAATGCGGCCTTTTCAGTCTTCATGGTGCTCATTACCCGGGCCATTTTGTCCTTTGATCTCAATTTCTAC
ATACCCATCAAGAGGGTGGACGAGAATATGGAAAGGGCACACGCACTCGATGCTGTACTCAATCAAAAGTTTTTC
TTTCGCAAGAATCCCTTCCCGCCTCGAGCGTCGCGTGCCAATACGGCATTTGGGGGCGGAGAAGAGTCGCGGCCC
GGCTCTGCCATGCCTAGCAGGCCTGGATCGCCGCCGCCGGGCCCCGTAGAGGACGAGTACTGCGAAATGTCGATT
GACGAGATTGTAAATGGCAGCGCCGAGGGCGATTTCCCCGGGCTCATTCCCATTGTGGAGAGCTACCTGGACAGC
GTCAATGTCGACGTGGAGACGCGCTGCCGCCTATCGACATATCTCGATTTGATTGGGCGCCGTGCTTGTGGCCGG
CTGGATACGGCGGCGCGGTGGATCCGCAACTTTGTACAGTCGCACCCACGGTACGGGCGCGACAGCGTCGTCGAT
GACGAGATTGTGCACGACCTAGTGGGTGCCGTTATTGCCGTTGGCGAGCGCGAGGCCCGGGGCCAGGGGTTTGCC
CGTCTTGGAATTAACGGGCTTCATCGGTTGCTGGGACCATTTCGCGGCGGATGTGGCCAGCCTGAGACAGACCAG
GACAGCAACGGCGCCGTGGCAAACGAGGCAGTCGAGCCCGGGTCGCCGTCGCGGAAACGCAAAAGCGAATGGATC
GACGGCGAGGCGGTCAGGGTGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail