Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7003
Gene name
LocationContig_772:3682..5805
Strand+
Gene length (bp)2123
Transcript length (bp)1920
Coding sequence length (bp)1920
Protein length (aa) 640

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain 1.1E-20 536 638
PF05406 WGR WGR domain 1.7E-08 291 357
PF00533 BRCT BRCA1 C Terminus (BRCT) domain 3.2E-07 15 94

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O88554|PARP2_MOUSE Poly [ADP-ribose] polymerase 2 OS=Mus musculus GN=Parp2 PE=1 SV=3 217 637 2.0E-28
sp|Q9UGN5|PARP2_HUMAN Poly [ADP-ribose] polymerase 2 OS=Homo sapiens GN=PARP2 PE=1 SV=2 253 637 2.0E-26
sp|P27008|PARP1_RAT Poly [ADP-ribose] polymerase 1 OS=Rattus norvegicus GN=Parp1 PE=1 SV=4 294 637 2.0E-24
sp|P18493|PARP1_BOVIN Poly [ADP-ribose] polymerase 1 OS=Bos taurus GN=PARP1 PE=2 SV=2 294 637 8.0E-24
sp|P11103|PARP1_MOUSE Poly [ADP-ribose] polymerase 1 OS=Mus musculus GN=Parp1 PE=1 SV=3 294 637 1.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O88554|PARP2_MOUSE Poly [ADP-ribose] polymerase 2 OS=Mus musculus GN=Parp2 PE=1 SV=3 217 637 2.0E-28
sp|Q9UGN5|PARP2_HUMAN Poly [ADP-ribose] polymerase 2 OS=Homo sapiens GN=PARP2 PE=1 SV=2 253 637 2.0E-26
sp|P27008|PARP1_RAT Poly [ADP-ribose] polymerase 1 OS=Rattus norvegicus GN=Parp1 PE=1 SV=4 294 637 2.0E-24
sp|P18493|PARP1_BOVIN Poly [ADP-ribose] polymerase 1 OS=Bos taurus GN=PARP1 PE=2 SV=2 294 637 8.0E-24
sp|P11103|PARP1_MOUSE Poly [ADP-ribose] polymerase 1 OS=Mus musculus GN=Parp1 PE=1 SV=3 294 637 1.0E-23
sp|P09874|PARP1_HUMAN Poly [ADP-ribose] polymerase 1 OS=Homo sapiens GN=PARP1 PE=1 SV=4 294 637 1.0E-23
sp|P31669|PARP1_XENLA Poly [ADP-ribose] polymerase 1 (Fragment) OS=Xenopus laevis GN=parp1 PE=2 SV=1 215 637 2.0E-23
sp|Q9R152|PARP1_CRIGR Poly [ADP-ribose] polymerase 1 OS=Cricetulus griseus GN=PARP1 PE=2 SV=3 294 637 3.0E-23
sp|P26446|PARP1_CHICK Poly [ADP-ribose] polymerase 1 OS=Gallus gallus GN=PARP1 PE=1 SV=2 230 637 4.0E-22
sp|Q9N4H4|PME1_CAEEL Poly(ADP-ribose) polymerase pme-1 OS=Caenorhabditis elegans GN=pme-1 PE=2 SV=1 256 639 1.0E-19
sp|P35875|PARP_DROME Poly [ADP-ribose] polymerase OS=Drosophila melanogaster GN=Parp PE=2 SV=1 256 637 1.0E-19
sp|Q11208|PARP_SARPE Poly [ADP-ribose] polymerase OS=Sarcophaga peregrina PE=1 SV=1 294 637 2.0E-19
sp|Q5Z8Q9|PRP2A_ORYSJ Poly [ADP-ribose] polymerase 2-A OS=Oryza sativa subsp. japonica GN=PARP2-A PE=3 SV=2 163 637 2.0E-19
sp|Q9ZP54|PARP1_ARATH Poly [ADP-ribose] polymerase 1 OS=Arabidopsis thaliana GN=PARP1 PE=1 SV=2 267 638 3.0E-19
sp|O50017|PARP2_MAIZE Poly [ADP-ribose] polymerase 2 OS=Zea mays GN=PARP2 PE=2 SV=1 276 637 3.0E-19
sp|Q9ZSV1|PARP1_MAIZE Poly [ADP-ribose] polymerase 1 OS=Zea mays GN=PARP1 PE=2 SV=1 268 637 2.0E-16
sp|Q9Y6F1|PARP3_HUMAN Poly [ADP-ribose] polymerase 3 OS=Homo sapiens GN=PARP3 PE=1 SV=3 247 638 9.0E-16
sp|Q7EYV7|PARP1_ORYSJ Poly [ADP-ribose] polymerase 1 OS=Oryza sativa subsp. japonica GN=PARP1 PE=2 SV=1 268 638 3.0E-15
sp|Q0JMY1|PRP2B_ORYSJ Poly [ADP-ribose] polymerase 2-B OS=Oryza sativa subsp. japonica GN=PARP2-B PE=3 SV=2 488 637 7.0E-15
sp|Q11207|PARP2_ARATH Poly [ADP-ribose] polymerase 2 OS=Arabidopsis thaliana GN=PARP2 PE=2 SV=1 276 637 2.0E-14
sp|Q08824|PARP1_ONCMA Poly [ADP-ribose] polymerase 1 (Fragment) OS=Oncorhynchus masou GN=parp1 PE=2 SV=2 479 612 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003950 NAD+ ADP-ribosyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016763 pentosyltransferase activity No
GO:0016740 transferase activity No
GO:0016757 glycosyltransferase activity No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6759
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7003 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1932
Ophiocordyceps subramaniannii Hirsu2|7994

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7003
MPRIRASTFSDPFLTPPLKGYTIAVTGNLRRWNHNIPTMHALIAILGGKTSSKVTASVTHLISTRIDFTNDVVAV
KAARAQDIPIVKPDWVLECRMQHRKVPLDGFLLTLGPRRKRRLDDAAEDDGVGSDRVKRVKRAADGGEQVAKFGN
DKTDATDAAAVDKTKQDATAVDNPKQDAAAVDKPKQDAAASTGKEKARSAKKGKLAPIVPIITGQISPDALKANK
TEPKSPPKDSKPAPKAKKEKPPPEKPLEARIDPKCPLSSWCVYIDHSAKIIYDVSLIMPGDPKTDHKYDSHYRMQ
LLHNSPSDEYRTWTRWGVRGEMEQTCIHGDGTFADAELTFQQRFVERTGVSWEDRKDAYKPGKYIHYKDTHANSS
TTKGLFKRPGKTTKVACSLSKPVQSVLALIFDRASHYSISYHNSVQVFPIKGGDEGHEILQDLDDLFCNPSLAKS
CWLSTLSEAKELLSAKLRSPAYLHQKPWVSLVSNRIDLLTRFRMLDQLTKDQIANIAPRDSLTVHPFDLDFSSLG
MDEFVPLDQISREYQTLYDLLAKTRSPGHKFSHTVENIFRIKRRGEAVRFAESRFATLKKSNRRLLWHGSAYPNF
AYILSQGLRNPPNTITQDLPLGRGVFLADISSKSLNFIQ*
Coding >OphauG2|7003
ATGCCTCGAATCCGAGCCTCAACCTTCTCAGACCCATTTCTAACCCCCCCCCTCAAAGGCTACACCATTGCCGTG
ACAGGTAACCTTCGACGATGGAACCACAACATTCCCACCATGCACGCCCTCATCGCCATCCTCGGCGGCAAAACC
TCATCCAAAGTCACCGCCAGCGTCACACACCTCATCTCCACACGGATTGACTTTACCAACGACGTTGTCGCTGTA
AAAGCAGCCAGAGCGCAAGACATACCCATCGTGAAGCCAGATTGGGTGCTCGAGTGCCGCATGCAGCATAGAAAA
GTCCCGCTTGACGGCTTTCTTCTCACGCTGGGGCCGAGACGGAAACGAAGACTTGACGATGCGGCTGAGGATGAT
GGTGTCGGTTCAGATCGCGTCAAACGGGTCAAGAGAGCAGCCGACGGGGGGGAACAAGTTGCCAAATTCGGCAAT
GACAAGACGGATGCTACAGATGCTGCTGCAGTAGATAAAACCAAGCAAGATGCTACTGCAGTGGATAACCCCAAA
CAAGATGCTGCTGCAGTTGATAAACCCAAGCAAGACGCTGCTGCGAGTACCGGCAAGGAAAAAGCCAGGTCTGCA
AAAAAGGGCAAGCTAGCGCCCATTGTCCCCATCATCACCGGCCAAATCTCGCCAGATGCCCTCAAAGCAAACAAG
ACCGAGCCCAAGTCTCCCCCAAAGGACTCCAAACCCGCCCCAAAAGCAAAGAAAGAAAAACCCCCGCCCGAAAAG
CCACTCGAAGCAAGAATCGACCCCAAATGCCCCCTCTCATCCTGGTGTGTCTACATTGACCATTCCGCCAAGATT
ATCTACGACGTCAGCCTCATCATGCCCGGCGACCCAAAGACGGACCACAAGTACGATTCACACTACCGGATGCAA
CTCCTACACAACTCCCCATCCGACGAGTACCGAACCTGGACGCGCTGGGGCGTCAGAGGCGAAATGGAACAAACC
TGCATCCATGGAGACGGCACCTTTGCCGATGCAGAGCTCACTTTTCAACAGCGCTTCGTCGAGCGCACAGGCGTG
TCCTGGGAGGACCGTAAAGACGCGTACAAGCCGGGCAAATACATCCACTACAAAGACACCCATGCCAACTCATCC
ACCACCAAGGGTCTTTTCAAGCGACCAGGAAAAACTACCAAAGTGGCCTGTTCGCTATCAAAGCCTGTGCAAAGT
GTCCTTGCTCTGATTTTCGACCGCGCCTCTCATTATTCCATTTCTTACCATAACAGCGTTCAAGTTTTCCCCATC
AAAGGGGGCGACGAAGGCCATGAGATTCTTCAAGACCTTGATGATTTATTCTGTAATCCATCACTTGCAAAGTCT
TGCTGGCTTTCCACACTTTCGGAAGCCAAGGAGCTCTTGTCCGCCAAGTTGCGTAGCCCAGCGTACTTACATCAG
AAGCCCTGGGTCTCTCTCGTTTCCAACAGAATTGATCTTCTGACTCGCTTTCGCATGCTCGATCAGTTGACAAAG
GACCAAATAGCCAATATAGCCCCCCGAGATTCTCTGACTGTGCATCCCTTTGATCTCGACTTCTCAAGCCTCGGC
ATGGACGAATTCGTGCCCCTCGACCAGATCAGCAGAGAATACCAAACCCTCTATGATCTACTCGCAAAGACTAGA
AGTCCTGGACATAAATTCAGCCACACGGTGGAGAATATTTTTCGCATCAAGCGTCGCGGCGAGGCAGTTCGATTT
GCCGAATCACGCTTTGCCACTCTTAAAAAATCAAATCGCCGCCTGCTTTGGCACGGCTCTGCTTATCCCAACTTT
GCCTATATACTCAGTCAGGGTCTACGAAATCCTCCCAACACTATCACTCAGGATCTTCCGCTTGGTAGAGGAGTT
TTTCTCGCTGACATATCTTCCAAGTCGTTAAACTTTATTCAATAG
Transcript >OphauG2|7003
ATGCCTCGAATCCGAGCCTCAACCTTCTCAGACCCATTTCTAACCCCCCCCCTCAAAGGCTACACCATTGCCGTG
ACAGGTAACCTTCGACGATGGAACCACAACATTCCCACCATGCACGCCCTCATCGCCATCCTCGGCGGCAAAACC
TCATCCAAAGTCACCGCCAGCGTCACACACCTCATCTCCACACGGATTGACTTTACCAACGACGTTGTCGCTGTA
AAAGCAGCCAGAGCGCAAGACATACCCATCGTGAAGCCAGATTGGGTGCTCGAGTGCCGCATGCAGCATAGAAAA
GTCCCGCTTGACGGCTTTCTTCTCACGCTGGGGCCGAGACGGAAACGAAGACTTGACGATGCGGCTGAGGATGAT
GGTGTCGGTTCAGATCGCGTCAAACGGGTCAAGAGAGCAGCCGACGGGGGGGAACAAGTTGCCAAATTCGGCAAT
GACAAGACGGATGCTACAGATGCTGCTGCAGTAGATAAAACCAAGCAAGATGCTACTGCAGTGGATAACCCCAAA
CAAGATGCTGCTGCAGTTGATAAACCCAAGCAAGACGCTGCTGCGAGTACCGGCAAGGAAAAAGCCAGGTCTGCA
AAAAAGGGCAAGCTAGCGCCCATTGTCCCCATCATCACCGGCCAAATCTCGCCAGATGCCCTCAAAGCAAACAAG
ACCGAGCCCAAGTCTCCCCCAAAGGACTCCAAACCCGCCCCAAAAGCAAAGAAAGAAAAACCCCCGCCCGAAAAG
CCACTCGAAGCAAGAATCGACCCCAAATGCCCCCTCTCATCCTGGTGTGTCTACATTGACCATTCCGCCAAGATT
ATCTACGACGTCAGCCTCATCATGCCCGGCGACCCAAAGACGGACCACAAGTACGATTCACACTACCGGATGCAA
CTCCTACACAACTCCCCATCCGACGAGTACCGAACCTGGACGCGCTGGGGCGTCAGAGGCGAAATGGAACAAACC
TGCATCCATGGAGACGGCACCTTTGCCGATGCAGAGCTCACTTTTCAACAGCGCTTCGTCGAGCGCACAGGCGTG
TCCTGGGAGGACCGTAAAGACGCGTACAAGCCGGGCAAATACATCCACTACAAAGACACCCATGCCAACTCATCC
ACCACCAAGGGTCTTTTCAAGCGACCAGGAAAAACTACCAAAGTGGCCTGTTCGCTATCAAAGCCTGTGCAAAGT
GTCCTTGCTCTGATTTTCGACCGCGCCTCTCATTATTCCATTTCTTACCATAACAGCGTTCAAGTTTTCCCCATC
AAAGGGGGCGACGAAGGCCATGAGATTCTTCAAGACCTTGATGATTTATTCTGTAATCCATCACTTGCAAAGTCT
TGCTGGCTTTCCACACTTTCGGAAGCCAAGGAGCTCTTGTCCGCCAAGTTGCGTAGCCCAGCGTACTTACATCAG
AAGCCCTGGGTCTCTCTCGTTTCCAACAGAATTGATCTTCTGACTCGCTTTCGCATGCTCGATCAGTTGACAAAG
GACCAAATAGCCAATATAGCCCCCCGAGATTCTCTGACTGTGCATCCCTTTGATCTCGACTTCTCAAGCCTCGGC
ATGGACGAATTCGTGCCCCTCGACCAGATCAGCAGAGAATACCAAACCCTCTATGATCTACTCGCAAAGACTAGA
AGTCCTGGACATAAATTCAGCCACACGGTGGAGAATATTTTTCGCATCAAGCGTCGCGGCGAGGCAGTTCGATTT
GCCGAATCACGCTTTGCCACTCTTAAAAAATCAAATCGCCGCCTGCTTTGGCACGGCTCTGCTTATCCCAACTTT
GCCTATATACTCAGTCAGGGTCTACGAAATCCTCCCAACACTATCACTCAGGATCTTCCGCTTGGTAGAGGAGTT
TTTCTCGCTGACATATCTTCCAAGTCGTTAAACTTTATTCAATAG
Gene >OphauG2|7003
ATGCCTCGAATCCGAGCCTCAACCTTCTCAGACCCATTTCTAACCCCCCCCCTCAAAGGCTACACCATTGCCGTG
ACAGGTAACCTTCGACGATGGAACCACAACATTCCCACCATGCACGCCCTCATCGCCATCCTCGGCGGCAAAACC
TCATCCAAAGTCACCGCCAGCGTCACACACCTCATCTCCACACGGATTGACTTTACCAACGACGTTGTCGCTGTA
AAAGCAGCCAGAGCGCAAGACATACCCATCGTGAAGCCAGATTGGGTGCTCGAGTGCCGCATGCAGCATAGAAAA
GTCCCGCTTGACGGCTTTCTTCTCACGCTGGGGCCGAGACGGAAACGAAGACTTGACGATGCGGCTGAGGATGAT
GGTGTCGGTTCAGATCGCGTCAAACGGGTCAAGAGAGCAGCCGACGGGGGGGAACAAGTTGCCAAATTCGGCAAT
GACAAGACGGATGCTACAGATGCTGCTGCAGTAGATAAAACCAAGCAAGATGCTACTGCAGTGGATAACCCCAAA
CAAGATGCTGCTGCAGTTGATAAACCCAAGCAAGACGCTGCTGCGAGTACCGGCAAGGAAAAAGCCAGGTCTGCA
AAAAAGGGCAAGCTAGCGCCCATTGTCCCCATCATCACCGGCCAAATCTCGCCAGATGCCCTCAAAGCAAACAAG
ACCGAGCCCAAGTCTCCCCCAAAGGACTCCAAACCCGCCCCAAAAGCAAAGAAAGAAAAACCCCCGCCCGAAAAG
CCACTCGAAGCAAGAATCGACCCCAAATGCCCCCTCTCATCCTGGTGTGTCTACATTGACCATTCCGCCAAGATT
ATCTACGACGTCAGCCTCATCATGCCCGGCGACCCAAAGACGGACCACAAGTACGATTCACACTACCGGATGCAA
GTACGTTCAACTCCCCCCATGCTTTTCTCCAAGCTTTCCACATCCCCCCCTCCCTCCCCTCTAACATATACAGCT
CCTACACAACTCCCCATCCGACGAGTACCGAACCTGGACGCGCTGGGGCGTCAGAGGCGAAATGGAACAAACCTG
CATCCATGGAGACGGCACCTTTGCCGATGCAGAGCTCACTTTTCAACAGCGCTTCGTCGAGCGCACAGGCGTGTC
CTGGGAGGACCGTAAAGACGCGTACAAGCCGGGCAAATACATCCACTACAAAGACACCCATGCCAACTCATCCAC
CACCAAGGGTCTTTTCAAGCGACCAGGAAAAACTACCAAAGTGGCCTGTTCGCTATCAAAGCCTGTGCAAAGTGT
CCTTGCTCTGATTTTCGACCGCGCCTCTCATTATTCCATTTCTTACCATAACAGCGTTCAAGTTTTCCCCATCAA
AGGGGGCGACGAAGGCCATGAGATTCTTCAAGACCTTGATGATTTATTCTGTAATCCATCACTTGCAAAGTCTTG
CTGGCTTTCCACACTTTCGGAAGCCAAGGAGCTCTTGTCCGCCAAGTTGCGTAGCCCAGCGTACTTACATCAGAA
GCCCTGGGTCTCTCTCGTTTCCAACAGAATTGATCTTCTGACTCGCTTTCGCATGCTCGATCAGTTGACAAAGGA
CCAAATAGCCAATATAGCCCCCCGAGATTCTCTGACTGTGCATCCCTTTGATCTCGACTTCTCAAGCCTCGGCAT
GGACGAATTCGTGCCCCTCGACCAGATCAGCAGAGAATACCAAACCCTCTATGATCTACTCGCAAAGACTAGAAG
TCCTGGACATAAATTCAGCCACACGGTGGAGAATATTTTTCGCATCAAGCGTCGCGGCGAGGCAGTTCGATTTGC
CGAATCACGCTTTGCCACTCTTAAAAAATCAAATCGCCGCCTGCTTTGGCACGGCTCTGCTTATCCCAACTTTGC
CTATATACTCAGTCAGGGTCTACGAAATCCTCCCAACACTATCACTCAGGATCTTCCGCTTGGTAGAGGAGTTTT
TCTCGCTGACATATCTTCCAAGTCGTTAAACTTTAGTGCGTCGATGAGGCATTTTAAAAATGAGTATATGTTGCT
CCTGTGTGAGGTCGAGCTTGGCGACCCCTTGCATGATTGGAAAACTTTCCCAAACAGCATCGAAGATATGACACT
CAATGGTATGATTAGTTCAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail