Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6982
Gene name
LocationContig_769:1105..3227
Strand-
Gene length (bp)2122
Transcript length (bp)2061
Coding sequence length (bp)2061
Protein length (aa) 687

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12222 PNGaseA Peptide N-acetyl-beta-D-glucosaminyl asparaginase amidase A 1.4E-118 114 521

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P81898|PNAA_PRUDU Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A OS=Prunus dulcis PE=1 SV=2 125 600 6.0E-47

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6982
MRFVSSLCLSLLLPLALLVACIEELGEEVREDIWVPEFYLDPDPNPINALKGGDGAPPLSFYTDEVSWQDTPSPQ
ANDSVEPLRCFQVSPPVLDSHGLVVGHEYVDEYEEELAGCQVHLLDNVPFANSYGHPHVVEYTPPNCRFNRVVIN
MTVTSSGRQFDRLGSLWLGDVEAWRFSTAEPKPGPGIVWTQWKDVTHLKKLWTMNQTIILDLGNLVNEKYTAPYY
VTLTARFFRRKRGKFDPVLRPADQIEAITAKRSKAGLGSALVYEGEPVQSWLQLPRNIVRAVISIAATGQGDEEF
WWANVPDDAVDVFRPNVTLPGRGGYRELRVLIDGHLVGLVFPFPIVFTGGISPPMHRPLVGPQAFDLREHQIDVT
PWLGLLCNGQRLNVTIQVVAHDGHPVPSSWVISGKMFLWLGIEGTISQGNKPRVKMVNQDDPPRILTDPPHSLSY
RHIIDRLFTVESEISRHNHTDTVFWNQTFAGKNRGFVARYGDMQQVHSTFHGEDTWQERGLPVYYHSYTYPIVSS
YDTQPGKDPYVTITNASLTHGEEFVMSGRGVFPTGLEAFDFPETFPYVKGGISLSNLRSARGLFFQRRNGSSFGF
GTASEGFRLGARAFYHELTNPQRIADPALYNRKVTVVNESIMEDTWDLYRPRGIMQLQEPRARKIGLLGNQFVAS
GRLPAVQRKGN*
Coding >OphauG2|6982
ATGCGTTTCGTCTCGTCCCTTTGCCTGTCCCTGCTCCTGCCCCTGGCTTTGCTCGTCGCCTGTATAGAGGAGTTG
GGGGAGGAGGTGAGGGAGGATATTTGGGTGCCCGAATTTTATCTCGACCCCGACCCAAACCCAATAAACGCATTA
AAGGGAGGGGATGGAGCGCCACCTTTATCTTTCTACACTGACGAGGTGTCGTGGCAAGACACTCCTTCTCCACAA
GCCAACGACTCTGTAGAGCCACTACGCTGCTTCCAGGTTTCTCCTCCGGTGCTGGATAGCCATGGTCTCGTTGTC
GGCCACGAATACGTGGATGAATATGAAGAGGAATTGGCCGGTTGCCAAGTGCATCTGCTCGACAACGTGCCCTTT
GCTAATAGCTATGGTCATCCGCATGTCGTCGAGTACACGCCCCCCAACTGTCGCTTCAACAGAGTCGTCATCAAT
ATGACGGTAACATCCTCTGGGCGCCAGTTTGATAGGCTGGGCTCGCTCTGGCTGGGCGACGTCGAAGCCTGGCGA
TTTTCTACCGCCGAGCCCAAGCCTGGTCCCGGTATTGTCTGGACGCAGTGGAAAGATGTCACGCACCTCAAGAAG
CTGTGGACCATGAACCAGACCATCATTCTGGACCTGGGCAATCTCGTCAATGAAAAATACACAGCGCCGTACTAT
GTGACCCTAACGGCCCGCTTCTTCAGGCGCAAGAGGGGCAAATTCGACCCAGTGCTACGACCGGCCGACCAGATC
GAGGCCATCACGGCCAAACGCTCAAAGGCCGGGTTAGGAAGCGCCTTGGTGTACGAGGGAGAGCCGGTCCAGTCA
TGGCTACAACTTCCCCGCAACATAGTGCGCGCTGTCATTTCCATTGCCGCCACTGGCCAAGGCGACGAGGAGTTC
TGGTGGGCCAATGTGCCCGACGACGCCGTCGACGTCTTCCGCCCCAATGTCACGCTTCCAGGTCGTGGGGGCTAT
CGGGAATTGCGTGTCTTGATAGACGGCCATCTTGTTGGCCTGGTCTTCCCCTTTCCAATCGTCTTCACGGGCGGC
ATTTCTCCGCCCATGCACCGGCCCCTTGTTGGACCTCAGGCTTTTGACTTGCGCGAGCACCAGATAGATGTGACG
CCGTGGCTTGGTCTGCTGTGCAACGGCCAGCGCCTCAATGTCACCATCCAAGTGGTTGCTCACGATGGCCACCCT
GTTCCGAGCTCCTGGGTCATCTCGGGCAAGATGTTTCTGTGGCTAGGAATTGAAGGCACCATCAGCCAGGGCAAC
AAACCTCGCGTGAAAATGGTCAATCAAGACGATCCGCCCCGCATCTTAACCGATCCGCCGCACTCTCTAAGTTAC
CGGCACATTATCGACCGCTTATTCACGGTTGAATCGGAAATAAGCAGACACAACCATACGGATACAGTCTTCTGG
AACCAGACGTTTGCGGGCAAGAATCGTGGCTTCGTGGCCAGATATGGCGACATGCAACAAGTCCACTCCACCTTT
CATGGCGAAGACACTTGGCAGGAGAGAGGACTTCCCGTGTATTATCACTCGTACACGTATCCCATCGTCTCGTCA
TATGACACGCAGCCTGGAAAGGATCCCTATGTCACCATTACTAATGCCAGCTTGACGCACGGCGAGGAGTTTGTC
ATGTCCGGGCGTGGTGTCTTCCCTACCGGTCTCGAGGCCTTTGACTTCCCCGAAACCTTTCCCTATGTGAAGGGC
GGCATTAGCCTGAGCAACCTCCGCAGTGCGCGAGGCCTCTTCTTTCAGCGCCGCAACGGCTCCTCGTTTGGCTTC
GGCACTGCCAGTGAAGGCTTTCGCTTGGGCGCTCGTGCCTTTTACCACGAGCTCACCAATCCCCAACGCATTGCG
GATCCAGCACTCTATAATCGCAAAGTCACTGTGGTTAATGAGTCTATTATGGAAGATACGTGGGACCTTTACAGG
CCTAGAGGAATTATGCAGCTCCAAGAGCCTCGAGCTCGAAAAATTGGCCTGCTTGGCAATCAATTCGTCGCCTCC
GGACGTTTGCCTGCGGTTCAGCGGAAGGGAAATTGA
Transcript >OphauG2|6982
ATGCGTTTCGTCTCGTCCCTTTGCCTGTCCCTGCTCCTGCCCCTGGCTTTGCTCGTCGCCTGTATAGAGGAGTTG
GGGGAGGAGGTGAGGGAGGATATTTGGGTGCCCGAATTTTATCTCGACCCCGACCCAAACCCAATAAACGCATTA
AAGGGAGGGGATGGAGCGCCACCTTTATCTTTCTACACTGACGAGGTGTCGTGGCAAGACACTCCTTCTCCACAA
GCCAACGACTCTGTAGAGCCACTACGCTGCTTCCAGGTTTCTCCTCCGGTGCTGGATAGCCATGGTCTCGTTGTC
GGCCACGAATACGTGGATGAATATGAAGAGGAATTGGCCGGTTGCCAAGTGCATCTGCTCGACAACGTGCCCTTT
GCTAATAGCTATGGTCATCCGCATGTCGTCGAGTACACGCCCCCCAACTGTCGCTTCAACAGAGTCGTCATCAAT
ATGACGGTAACATCCTCTGGGCGCCAGTTTGATAGGCTGGGCTCGCTCTGGCTGGGCGACGTCGAAGCCTGGCGA
TTTTCTACCGCCGAGCCCAAGCCTGGTCCCGGTATTGTCTGGACGCAGTGGAAAGATGTCACGCACCTCAAGAAG
CTGTGGACCATGAACCAGACCATCATTCTGGACCTGGGCAATCTCGTCAATGAAAAATACACAGCGCCGTACTAT
GTGACCCTAACGGCCCGCTTCTTCAGGCGCAAGAGGGGCAAATTCGACCCAGTGCTACGACCGGCCGACCAGATC
GAGGCCATCACGGCCAAACGCTCAAAGGCCGGGTTAGGAAGCGCCTTGGTGTACGAGGGAGAGCCGGTCCAGTCA
TGGCTACAACTTCCCCGCAACATAGTGCGCGCTGTCATTTCCATTGCCGCCACTGGCCAAGGCGACGAGGAGTTC
TGGTGGGCCAATGTGCCCGACGACGCCGTCGACGTCTTCCGCCCCAATGTCACGCTTCCAGGTCGTGGGGGCTAT
CGGGAATTGCGTGTCTTGATAGACGGCCATCTTGTTGGCCTGGTCTTCCCCTTTCCAATCGTCTTCACGGGCGGC
ATTTCTCCGCCCATGCACCGGCCCCTTGTTGGACCTCAGGCTTTTGACTTGCGCGAGCACCAGATAGATGTGACG
CCGTGGCTTGGTCTGCTGTGCAACGGCCAGCGCCTCAATGTCACCATCCAAGTGGTTGCTCACGATGGCCACCCT
GTTCCGAGCTCCTGGGTCATCTCGGGCAAGATGTTTCTGTGGCTAGGAATTGAAGGCACCATCAGCCAGGGCAAC
AAACCTCGCGTGAAAATGGTCAATCAAGACGATCCGCCCCGCATCTTAACCGATCCGCCGCACTCTCTAAGTTAC
CGGCACATTATCGACCGCTTATTCACGGTTGAATCGGAAATAAGCAGACACAACCATACGGATACAGTCTTCTGG
AACCAGACGTTTGCGGGCAAGAATCGTGGCTTCGTGGCCAGATATGGCGACATGCAACAAGTCCACTCCACCTTT
CATGGCGAAGACACTTGGCAGGAGAGAGGACTTCCCGTGTATTATCACTCGTACACGTATCCCATCGTCTCGTCA
TATGACACGCAGCCTGGAAAGGATCCCTATGTCACCATTACTAATGCCAGCTTGACGCACGGCGAGGAGTTTGTC
ATGTCCGGGCGTGGTGTCTTCCCTACCGGTCTCGAGGCCTTTGACTTCCCCGAAACCTTTCCCTATGTGAAGGGC
GGCATTAGCCTGAGCAACCTCCGCAGTGCGCGAGGCCTCTTCTTTCAGCGCCGCAACGGCTCCTCGTTTGGCTTC
GGCACTGCCAGTGAAGGCTTTCGCTTGGGCGCTCGTGCCTTTTACCACGAGCTCACCAATCCCCAACGCATTGCG
GATCCAGCACTCTATAATCGCAAAGTCACTGTGGTTAATGAGTCTATTATGGAAGATACGTGGGACCTTTACAGG
CCTAGAGGAATTATGCAGCTCCAAGAGCCTCGAGCTCGAAAAATTGGCCTGCTTGGCAATCAATTCGTCGCCTCC
GGACGTTTGCCTGCGGTTCAGCGGAAGGGAAATTGA
Gene >OphauG2|6982
ATGCGTTTCGTCTCGTCCCTTTGCCTGTCCCTGCTCCTGCCCCTGGCTTTGCTCGTCGCCTGTATAGAGGAGTTG
GGGGAGGAGGTGAGGGAGGATATTTGGGTGCCCGAATTTTATCTCGACCCCGACCCAAACCCAATAAACGCATTA
AAGGGAGGGGATGGAGCGCCACCTTTATCTTTCTACACTGACGAGGTGTCGTGGCAAGACACTCCTTCTCCACAA
GCCAACGACTCTGTAGAGCCACTACGCTGCTTCCAGGTTTCTCCTCCGGTGCTGGATAGCCATGGTCTCGTTGTC
GGCCACGAATACGTGGATGAATATGAAGAGGAATTGGCCGGTTGCCAAGTGCATCTGCTCGACAACGTGCCCTTT
GCTAATAGCTATGGTCATCCGCATGTCGGTAAGTCAAGGCGTCAGAATCTCCAATGCCTTGTTGACCTGCTAACG
TCAAGGATCAAAAGTCGAGTACACGCCCCCCAACTGTCGCTTCAACAGAGTCGTCATCAATATGACGGTAACATC
CTCTGGGCGCCAGTTTGATAGGCTGGGCTCGCTCTGGCTGGGCGACGTCGAAGCCTGGCGATTTTCTACCGCCGA
GCCCAAGCCTGGTCCCGGTATTGTCTGGACGCAGTGGAAAGATGTCACGCACCTCAAGAAGCTGTGGACCATGAA
CCAGACCATCATTCTGGACCTGGGCAATCTCGTCAATGAAAAATACACAGCGCCGTACTATGTGACCCTAACGGC
CCGCTTCTTCAGGCGCAAGAGGGGCAAATTCGACCCAGTGCTACGACCGGCCGACCAGATCGAGGCCATCACGGC
CAAACGCTCAAAGGCCGGGTTAGGAAGCGCCTTGGTGTACGAGGGAGAGCCGGTCCAGTCATGGCTACAACTTCC
CCGCAACATAGTGCGCGCTGTCATTTCCATTGCCGCCACTGGCCAAGGCGACGAGGAGTTCTGGTGGGCCAATGT
GCCCGACGACGCCGTCGACGTCTTCCGCCCCAATGTCACGCTTCCAGGTCGTGGGGGCTATCGGGAATTGCGTGT
CTTGATAGACGGCCATCTTGTTGGCCTGGTCTTCCCCTTTCCAATCGTCTTCACGGGCGGCATTTCTCCGCCCAT
GCACCGGCCCCTTGTTGGACCTCAGGCTTTTGACTTGCGCGAGCACCAGATAGATGTGACGCCGTGGCTTGGTCT
GCTGTGCAACGGCCAGCGCCTCAATGTCACCATCCAAGTGGTTGCTCACGATGGCCACCCTGTTCCGAGCTCCTG
GGTCATCTCGGGCAAGATGTTTCTGTGGCTAGGAATTGAAGGCACCATCAGCCAGGGCAACAAACCTCGCGTGAA
AATGGTCAATCAAGACGATCCGCCCCGCATCTTAACCGATCCGCCGCACTCTCTAAGTTACCGGCACATTATCGA
CCGCTTATTCACGGTTGAATCGGAAATAAGCAGACACAACCATACGGATACAGTCTTCTGGAACCAGACGTTTGC
GGGCAAGAATCGTGGCTTCGTGGCCAGATATGGCGACATGCAACAAGTCCACTCCACCTTTCATGGCGAAGACAC
TTGGCAGGAGAGAGGACTTCCCGTGTATTATCACTCGTACACGTATCCCATCGTCTCGTCATATGACACGCAGCC
TGGAAAGGATCCCTATGTCACCATTACTAATGCCAGCTTGACGCACGGCGAGGAGTTTGTCATGTCCGGGCGTGG
TGTCTTCCCTACCGGTCTCGAGGCCTTTGACTTCCCCGAAACCTTTCCCTATGTGAAGGGCGGCATTAGCCTGAG
CAACCTCCGCAGTGCGCGAGGCCTCTTCTTTCAGCGCCGCAACGGCTCCTCGTTTGGCTTCGGCACTGCCAGTGA
AGGCTTTCGCTTGGGCGCTCGTGCCTTTTACCACGAGCTCACCAATCCCCAACGCATTGCGGATCCAGCACTCTA
TAATCGCAAAGTCACTGTGGTTAATGAGTCTATTATGGAAGATACGTGGGACCTTTACAGGCCTAGAGGAATTAT
GCAGCTCCAAGAGCCTCGAGCTCGAAAAATTGGCCTGCTTGGCAATCAATTCGTCGCCTCCGGACGTTTGCCTGC
GGTTCAGCGGAAGGGAAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail