Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6977
Gene name
LocationContig_768:279..1014
Strand+
Gene length (bp)735
Transcript length (bp)678
Coding sequence length (bp)678
Protein length (aa) 226

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999725

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup305
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6977 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4294
Ophiocordyceps camponoti-floridani Ophcf2|02081
Ophiocordyceps camponoti-floridani Ophcf2|02093
Ophiocordyceps camponoti-floridani Ophcf2|07411
Ophiocordyceps camponoti-rufipedis Ophun1|2531
Ophiocordyceps camponoti-rufipedis Ophun1|730
Ophiocordyceps kimflemingae Ophio5|508
Ophiocordyceps kimflemingae Ophio5|8326
Ophiocordyceps subramaniannii Hirsu2|10709

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6977
MKLAPLHTCLVLGAMAATAQDIQSSPFQLVIQSVQDETLNGHRITACHIGGAIDSMCLAEADGATFFSNTSQGLL
SPLEGYEPASVLVWNFAGASRSISKPMSFYHDPSTNVAMPLFHAGYASRQQVTFDKAGRLAIISHMDDSKHPPAF
KAKALQNWFVCKNYENTSKRMSLAWVVGRGDVSPQNPTCVKVRVYRKYVSKGLKRQKQGRWKKKSSRGESKLRQS
*
Coding >OphauG2|6977
ATGAAGCTCGCACCACTCCACACCTGTCTCGTCCTCGGGGCCATGGCCGCCACCGCCCAGGACATCCAATCAAGT
CCCTTCCAGCTGGTCATTCAGTCAGTCCAAGACGAGACGCTCAACGGCCACAGGATTACGGCTTGTCACATTGGC
GGCGCCATCGATTCCATGTGCTTGGCTGAGGCTGATGGGGCAACCTTCTTTTCCAACACTTCACAGGGCTTGCTA
TCTCCGCTAGAGGGCTACGAGCCTGCCAGCGTGCTCGTGTGGAACTTTGCCGGTGCCTCAAGGTCCATCTCCAAG
CCCATGAGCTTCTACCACGATCCGTCTACCAATGTTGCCATGCCTCTGTTCCACGCTGGATACGCCTCTCGGCAG
CAAGTCACCTTTGACAAGGCTGGTCGGCTTGCCATTATTAGTCACATGGACGATAGCAAACATCCGCCAGCCTTC
AAGGCCAAAGCTTTACAGAACTGGTTCGTCTGCAAGAATTACGAAAACACCAGCAAGCGCATGTCACTTGCCTGG
GTTGTGGGAAGAGGTGACGTCAGTCCTCAGAATCCCACCTGCGTCAAGGTCCGAGTATACCGTAAGTACGTCTCC
AAGGGCCTGAAGCGCCAGAAGCAGGGTAGATGGAAGAAAAAGTCAAGTAGAGGGGAAAGTAAATTAAGACAAAGT
TGA
Transcript >OphauG2|6977
ATGAAGCTCGCACCACTCCACACCTGTCTCGTCCTCGGGGCCATGGCCGCCACCGCCCAGGACATCCAATCAAGT
CCCTTCCAGCTGGTCATTCAGTCAGTCCAAGACGAGACGCTCAACGGCCACAGGATTACGGCTTGTCACATTGGC
GGCGCCATCGATTCCATGTGCTTGGCTGAGGCTGATGGGGCAACCTTCTTTTCCAACACTTCACAGGGCTTGCTA
TCTCCGCTAGAGGGCTACGAGCCTGCCAGCGTGCTCGTGTGGAACTTTGCCGGTGCCTCAAGGTCCATCTCCAAG
CCCATGAGCTTCTACCACGATCCGTCTACCAATGTTGCCATGCCTCTGTTCCACGCTGGATACGCCTCTCGGCAG
CAAGTCACCTTTGACAAGGCTGGTCGGCTTGCCATTATTAGTCACATGGACGATAGCAAACATCCGCCAGCCTTC
AAGGCCAAAGCTTTACAGAACTGGTTCGTCTGCAAGAATTACGAAAACACCAGCAAGCGCATGTCACTTGCCTGG
GTTGTGGGAAGAGGTGACGTCAGTCCTCAGAATCCCACCTGCGTCAAGGTCCGAGTATACCGTAAGTACGTCTCC
AAGGGCCTGAAGCGCCAGAAGCAGGGTAGATGGAAGAAAAAGTCAAGTAGAGGGGAAAGTAAATTAAGACAAAGT
TGA
Gene >OphauG2|6977
ATGAAGCTCGCACCACTCCACACCTGTCTCGTCCTCGGGGCCATGGCCGCCACCGCCCAGGACATCCAATCAAGT
CCCTTCCAGCTGGTCATTCAGTCAGTCCAAGACGAGACGCTCAACGGCCACAGGATTACGGCTTGTCACATTGGC
GGCGCCATCGATTCCATGTGCTTGGCTGAGGCTGATGGGGCAACCTTCTTTTCCAACACTTCACAGGGCTTGCTA
TCTCCGCTAGAGGGCTACGAGCCTGCCAGCGTGCTCGTGTGGAACTTTGCCGGTGGTGGGTGATGCTGCTGCCGT
CTCCCGATATAGTCCTCTGACAGATGCGTTTGCATAGCCTCAAGGTCCATCTCCAAGCCCATGAGCTTCTACCAC
GATCCGTCTACCAATGTTGCCATGCCTCTGTTCCACGCTGGATACGCCTCTCGGCAGCAAGTCACCTTTGACAAG
GCTGGTCGGCTTGCCATTATTAGTCACATGGACGATAGCAAACATCCGCCAGCCTTCAAGGCCAAAGCTTTACAG
AACTGGTTCGTCTGCAAGAATTACGAAAACACCAGCAAGCGCATGTCACTTGCCTGGGTTGTGGGAAGAGGTGAC
GTCAGTCCTCAGAATCCCACCTGCGTCAAGGTCCGAGTATACCGTAAGTACGTCTCCAAGGGCCTGAAGCGCCAG
AAGCAGGGTAGATGGAAGAAAAAGTCAAGTAGAGGGGAAAGTAAATTAAGACAAAGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail