Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6956
Gene name
LocationContig_761:7080..8758
Strand+
Gene length (bp)1678
Transcript length (bp)1620
Coding sequence length (bp)1620
Protein length (aa) 540

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05577 Peptidase_S28 Serine carboxypeptidase S28 3.0E-35 49 212
PF05577 Peptidase_S28 Serine carboxypeptidase S28 1.8E-07 372 491

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AYS6|A1345_ARTBC Probable extracellular serine carboxypeptidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01345 PE=1 SV=1 33 526 1.0E-148
sp|Q9QXE5|TSSP_MOUSE Thymus-specific serine protease OS=Mus musculus GN=Prss16 PE=2 SV=1 36 489 4.0E-25
sp|Q1PF50|EDA2_ARATH Probable serine protease EDA2 OS=Arabidopsis thaliana GN=EDA2 PE=2 SV=2 51 474 5.0E-25
sp|P34528|YM67_CAEEL Putative serine protease K12H4.7 OS=Caenorhabditis elegans GN=K12H4.7 PE=3 SV=2 57 492 9.0E-24
sp|Q9NQE7|TSSP_HUMAN Thymus-specific serine protease OS=Homo sapiens GN=PRSS16 PE=2 SV=2 57 489 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AYS6|A1345_ARTBC Probable extracellular serine carboxypeptidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01345 PE=1 SV=1 33 526 1.0E-148
sp|Q9QXE5|TSSP_MOUSE Thymus-specific serine protease OS=Mus musculus GN=Prss16 PE=2 SV=1 36 489 4.0E-25
sp|Q1PF50|EDA2_ARATH Probable serine protease EDA2 OS=Arabidopsis thaliana GN=EDA2 PE=2 SV=2 51 474 5.0E-25
sp|P34528|YM67_CAEEL Putative serine protease K12H4.7 OS=Caenorhabditis elegans GN=K12H4.7 PE=3 SV=2 57 492 9.0E-24
sp|Q9NQE7|TSSP_HUMAN Thymus-specific serine protease OS=Homo sapiens GN=PRSS16 PE=2 SV=2 57 489 3.0E-22
sp|Q9EPB1|DPP2_RAT Dipeptidyl peptidase 2 OS=Rattus norvegicus GN=Dpp7 PE=1 SV=1 40 525 1.0E-16
sp|P90893|YM9I_CAEEL Putative serine protease F56F10.1 OS=Caenorhabditis elegans GN=F56F10.1 PE=1 SV=2 22 207 1.0E-15
sp|P34676|PCP5_CAEEL Prolyl carboxy peptidase like protein 5 OS=Caenorhabditis elegans GN=pcp-5 PE=1 SV=1 36 196 9.0E-14
sp|Q7TMR0|PCP_MOUSE Lysosomal Pro-X carboxypeptidase OS=Mus musculus GN=Prcp PE=1 SV=2 20 532 7.0E-13
sp|Q5RBU7|PCP_PONAB Lysosomal Pro-X carboxypeptidase OS=Pongo abelii GN=PRCP PE=2 SV=1 21 203 2.0E-12
sp|P42785|PCP_HUMAN Lysosomal Pro-X carboxypeptidase OS=Homo sapiens GN=PRCP PE=1 SV=1 21 203 7.0E-12
sp|Q9ET22|DPP2_MOUSE Dipeptidyl peptidase 2 OS=Mus musculus GN=Dpp7 PE=1 SV=2 40 525 1.0E-11
sp|Q9UHL4|DPP2_HUMAN Dipeptidyl peptidase 2 OS=Homo sapiens GN=DPP7 PE=1 SV=3 40 489 1.0E-11
sp|P34610|PCP1_CAEEL Putative serine protease pcp-1 OS=Caenorhabditis elegans GN=pcp-1 PE=1 SV=2 57 195 2.0E-09
sp|Q2TA14|PCP_BOVIN Lysosomal Pro-X carboxypeptidase OS=Bos taurus GN=PRCP PE=2 SV=1 15 203 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0043170 macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0017171 serine hydrolase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0008233 peptidase activity No
GO:0140096 catalytic activity, acting on a protein No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6956
MAVFSLLAALVGLVAAQSPPPASPSPSPPPIKAYNLSVPVDHFHNESKYEPHSSDFFNLRYWLDTSNYRPGGPVI
VLHSGETSSEDRLPYLEHGIVPELTAATGGVGLVLEHRYYGTSYPTANVTTQSLRFLTSEQALADTAYFAQHVTF
PGLEHVSLTAAHAPWIIYGGSYAGALAALARKLYPDVFWGGISSSGVTAAVDDYWQYFEAARHAAPGDCSATLQR
LVHVIDAHLCSGDQDRAKQLKELFGLGELWNDEFADTIKEGIEGLQSTNWDPNEDDAKFGLFCASITSDARLFAS
TAHLVPRVRQAVSSVYGDNDHHGVSLDSLVARMLNYIGFVRDSVRKSRAGICKDKSQRQCYSSRLLEDDTSISSS
WFRSWTYQTCTQWGYFVTGSGVPQDRLPLVSRALTYEYASVLCQRFFNITARPDVESINRHGGFEFSYPRLAIID
GAQDPWREATPHATGHNVGRGSSVTEPFLLIDWGVHHWDEYGLPLAERAQWEGLLPPPQVVGAQREEVRFVRAWL
EEWKGRVVREVGEI*
Coding >OphauG2|6956
ATGGCCGTCTTTAGCTTGCTCGCGGCTCTTGTCGGCCTTGTCGCAGCCCAATCACCCCCACCGGCTTCTCCAAGC
CCGTCGCCACCGCCCATCAAGGCATACAACCTTTCGGTGCCCGTTGATCATTTCCACAACGAGTCCAAGTACGAG
CCGCACTCGTCTGATTTCTTCAACCTGCGCTACTGGCTCGACACGTCAAACTACAGGCCCGGCGGCCCCGTCATT
GTCCTTCACTCGGGCGAGACGTCGAGCGAGGACCGTCTGCCCTATCTCGAGCATGGCATAGTTCCCGAGCTTACC
GCTGCGACGGGCGGCGTCGGCCTGGTGCTGGAGCATCGCTACTACGGCACCAGCTACCCTACTGCCAATGTCACG
ACGCAGAGCCTGCGCTTCTTGACCTCTGAGCAAGCCCTGGCTGACACGGCCTACTTTGCCCAGCACGTGACTTTT
CCCGGCCTGGAGCATGTCTCCTTGACGGCAGCCCATGCGCCTTGGATTATTTACGGCGGCTCCTATGCTGGTGCC
CTGGCAGCTTTGGCTCGCAAGCTATACCCTGATGTCTTTTGGGGCGGCATTTCTTCGTCTGGAGTCACGGCTGCT
GTTGATGACTACTGGCAGTATTTCGAGGCTGCTCGCCATGCTGCGCCGGGCGACTGCTCTGCTACCCTGCAGCGC
CTCGTACACGTCATTGACGCCCATTTGTGCAGCGGCGACCAAGACCGTGCCAAGCAACTCAAGGAGCTCTTTGGC
CTGGGCGAGCTGTGGAACGATGAATTTGCCGACACCATCAAGGAGGGCATCGAGGGGCTGCAGTCTACAAACTGG
GACCCAAACGAAGATGACGCCAAGTTTGGTCTCTTTTGCGCCTCGATTACGTCTGATGCTCGCTTGTTTGCCAGC
ACTGCCCACCTAGTACCTAGAGTGCGCCAGGCCGTGTCGTCTGTATATGGAGACAATGACCATCATGGTGTGAGT
CTTGATAGCTTGGTGGCTCGCATGCTCAACTATATTGGCTTTGTGCGTGACTCTGTGCGCAAGAGCCGCGCCGGG
ATATGCAAAGACAAGTCTCAGCGCCAGTGCTACTCGTCGCGCCTTTTGGAGGACGATACATCGATATCTTCTAGC
TGGTTTCGCAGCTGGACCTATCAGACATGCACACAATGGGGCTATTTTGTTACTGGAAGCGGCGTGCCTCAAGAC
CGCCTACCCCTCGTGTCTCGCGCCCTGACGTATGAATACGCCAGCGTCTTGTGCCAGCGCTTCTTCAACATTACC
GCGCGTCCCGACGTGGAGTCGATTAACCGCCACGGCGGCTTCGAGTTTAGCTATCCGCGCCTCGCCATTATTGAC
GGCGCGCAGGACCCGTGGCGTGAGGCGACGCCCCATGCAACGGGGCATAATGTCGGCCGCGGGTCGAGCGTGACG
GAGCCCTTTTTGCTCATTGACTGGGGAGTGCATCATTGGGATGAGTATGGGCTGCCGTTGGCCGAGAGAGCCCAG
TGGGAGGGACTGCTGCCGCCGCCGCAGGTGGTGGGTGCGCAGAGGGAGGAGGTGAGGTTTGTGAGGGCTTGGCTG
GAGGAGTGGAAGGGTAGGGTTGTGCGTGAGGTGGGTGAGATTTGA
Transcript >OphauG2|6956
ATGGCCGTCTTTAGCTTGCTCGCGGCTCTTGTCGGCCTTGTCGCAGCCCAATCACCCCCACCGGCTTCTCCAAGC
CCGTCGCCACCGCCCATCAAGGCATACAACCTTTCGGTGCCCGTTGATCATTTCCACAACGAGTCCAAGTACGAG
CCGCACTCGTCTGATTTCTTCAACCTGCGCTACTGGCTCGACACGTCAAACTACAGGCCCGGCGGCCCCGTCATT
GTCCTTCACTCGGGCGAGACGTCGAGCGAGGACCGTCTGCCCTATCTCGAGCATGGCATAGTTCCCGAGCTTACC
GCTGCGACGGGCGGCGTCGGCCTGGTGCTGGAGCATCGCTACTACGGCACCAGCTACCCTACTGCCAATGTCACG
ACGCAGAGCCTGCGCTTCTTGACCTCTGAGCAAGCCCTGGCTGACACGGCCTACTTTGCCCAGCACGTGACTTTT
CCCGGCCTGGAGCATGTCTCCTTGACGGCAGCCCATGCGCCTTGGATTATTTACGGCGGCTCCTATGCTGGTGCC
CTGGCAGCTTTGGCTCGCAAGCTATACCCTGATGTCTTTTGGGGCGGCATTTCTTCGTCTGGAGTCACGGCTGCT
GTTGATGACTACTGGCAGTATTTCGAGGCTGCTCGCCATGCTGCGCCGGGCGACTGCTCTGCTACCCTGCAGCGC
CTCGTACACGTCATTGACGCCCATTTGTGCAGCGGCGACCAAGACCGTGCCAAGCAACTCAAGGAGCTCTTTGGC
CTGGGCGAGCTGTGGAACGATGAATTTGCCGACACCATCAAGGAGGGCATCGAGGGGCTGCAGTCTACAAACTGG
GACCCAAACGAAGATGACGCCAAGTTTGGTCTCTTTTGCGCCTCGATTACGTCTGATGCTCGCTTGTTTGCCAGC
ACTGCCCACCTAGTACCTAGAGTGCGCCAGGCCGTGTCGTCTGTATATGGAGACAATGACCATCATGGTGTGAGT
CTTGATAGCTTGGTGGCTCGCATGCTCAACTATATTGGCTTTGTGCGTGACTCTGTGCGCAAGAGCCGCGCCGGG
ATATGCAAAGACAAGTCTCAGCGCCAGTGCTACTCGTCGCGCCTTTTGGAGGACGATACATCGATATCTTCTAGC
TGGTTTCGCAGCTGGACCTATCAGACATGCACACAATGGGGCTATTTTGTTACTGGAAGCGGCGTGCCTCAAGAC
CGCCTACCCCTCGTGTCTCGCGCCCTGACGTATGAATACGCCAGCGTCTTGTGCCAGCGCTTCTTCAACATTACC
GCGCGTCCCGACGTGGAGTCGATTAACCGCCACGGCGGCTTCGAGTTTAGCTATCCGCGCCTCGCCATTATTGAC
GGCGCGCAGGACCCGTGGCGTGAGGCGACGCCCCATGCAACGGGGCATAATGTCGGCCGCGGGTCGAGCGTGACG
GAGCCCTTTTTGCTCATTGACTGGGGAGTGCATCATTGGGATGAGTATGGGCTGCCGTTGGCCGAGAGAGCCCAG
TGGGAGGGACTGCTGCCGCCGCCGCAGGTGGTGGGTGCGCAGAGGGAGGAGGTGAGGTTTGTGAGGGCTTGGCTG
GAGGAGTGGAAGGGTAGGGTTGTGCGTGAGGTGGGTGAGATTTGA
Gene >OphauG2|6956
ATGGCCGTCTTTAGCTTGCTCGCGGCTCTTGTCGGCCTTGTCGCAGCCCAATCACCCCCACCGGCTTCTCCAAGC
CCGTCGCCACCGCCCATCAAGGCATACAACCTTTCGGTGCCCGTTGATCATTTCCACAACGAGTCCAAGTACGAG
CCGCACTCGTCTGATTTCTTCAACCTGCGCTACTGGCTCGACACGTCAAACTACAGGCCCGGCGGCCCCGTCATT
GTCCTTCACTCGGGCGAGACGTCGAGCGAGGACCGTCTGCCCTATCTCGAGCATGGCATAGTTCCCGAGCTTACC
GCTGCGACGGGCGGCGTCGGCCTGGTGCTGGAGCATCGCTACTACGGCACCAGCTACCCTACTGCCAATGTCACG
ACGCAGAGCCTGCGCTTCTTGACCTCTGAGCAAGCCCTGGCTGACACGGCCTACTTTGCCCAGCACGTGACTTTT
CCCGGCCTGGAGCATGTCTCCTTGACGGCAGCCCATGCGCCTTGGATTATTTACGGCGGCTCCTATGCTGGTGCC
CTGGCAGCTTTGGCTCGCAAGCTATACCCTGATGTCTTTTGGGGCGGCATTTCTTCGTCTGGAGTCACGGCTGCT
GTTGATGACTACTGGCAGTATTTCGAGGCTGCTCGCCATGCTGCGCCGGGCGACTGCTCTGCTACCCTGCAGCGC
CTCGTACACGTCATTGACGCCCATTTGTGCAGCGGCGACCAAGACCGTGCCAAGCAACTCAAGGAGCTCTTTGGC
CTGGGCGAGCTGTGGAACGATGAATTTGCCGACACCATCAAGGAGGGCATCGAGGGGCTGCAGTCTACAAACTGG
GACCCAAACGAAGATGACGCCAAGTTTGGTCTCTTTTGCGCCTCGATTACGTCTGATGCTCGCTTGTTTGCCAGC
ACTGCCCACCTAGTACCTAGAGTGCGCCAGGCCGTGTCGTCTGTATATGGAGACAATGACCATCATGGTGTGAGT
CTTGATAGCTTGGTGGCTCGCATGCTCAACTATATTGGCTTTGTGCGTGACTCTGTGCGCAAGAGCCGCGCCGGG
ATATGCAAAGACAAGTCTCAGCGCCAGTGCTACTCGTCGCGCCTTTTGGAGGACGATACATCGATATCTTCTAGC
TGGTTTCGCAGCTGGACCTATCAGACATGCACACAGTAAGTTCAATTTTTTTTTATTTTTTTTTTACAGACATTA
ATCTCTCGTCAACCACAGATGGGGCTATTTTGTTACTGGAAGCGGCGTGCCTCAAGACCGCCTACCCCTCGTGTC
TCGCGCCCTGACGTATGAATACGCCAGCGTCTTGTGCCAGCGCTTCTTCAACATTACCGCGCGTCCCGACGTGGA
GTCGATTAACCGCCACGGCGGCTTCGAGTTTAGCTATCCGCGCCTCGCCATTATTGACGGCGCGCAGGACCCGTG
GCGTGAGGCGACGCCCCATGCAACGGGGCATAATGTCGGCCGCGGGTCGAGCGTGACGGAGCCCTTTTTGCTCAT
TGACTGGGGAGTGCATCATTGGGATGAGTATGGGCTGCCGTTGGCCGAGAGAGCCCAGTGGGAGGGACTGCTGCC
GCCGCCGCAGGTGGTGGGTGCGCAGAGGGAGGAGGTGAGGTTTGTGAGGGCTTGGCTGGAGGAGTGGAAGGGTAG
GGTTGTGCGTGAGGTGGGTGAGATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail