Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6952
Gene name
LocationContig_760:6174..7622
Strand-
Gene length (bp)1448
Transcript length (bp)1368
Coding sequence length (bp)1368
Protein length (aa) 456

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00010 HLH Helix-loop-helix DNA-binding domain 1.4E-07 388 438

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0005488 binding No
GO:0005515 protein binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6952
MLAIQQAPRMGSSQPDSEPLLPFGYAVDPSHDLFDAPPDPAPGAPLLSETDSKFLSSFFEDMTANQYDMPSFGEG
LNFSDAWLDLPPQFMGTATSFGSHSSLDSTTDHSFSPPTTNGATDKQLHLQRMMPDSHLMPPPPPPPNQQQIYAQ
QHSDEVLNAAATLLQNGSTPRTVSHKSCDYSHARRSVGYPVGHLRHQPMEEFKEENRRSSLGTENDSNYSAWVWG
TKERTPQRKAPLPDFQWGSDSNFGPAQGYAPEASNESLDCLQKTHLKCLECLEVTNSATNTSPSSPNNHGPFDNE
GDDSIYVKTEDDLSGPPRKRRKSKNFRDAGDEDDEDDLAAVRSGRKRKPRSERIDTSPASDTPANGRRRKSVASG
SKVPRENLTEEQKRENHIRSEQKRRTLIKEGFDDLGELVPGLKGGGFSKSTTLAMAAEWLEELLRDNKALSAQLA
ALNGR*
Coding >OphauG2|6952
ATGCTCGCCATCCAGCAGGCTCCCAGGATGGGTTCATCGCAGCCTGATTCCGAGCCCCTGCTGCCATTTGGCTAT
GCCGTCGACCCAAGTCATGATCTCTTCGATGCGCCCCCAGATCCCGCCCCGGGCGCCCCTCTCCTATCCGAGACT
GATAGCAAGTTTCTCAGCTCCTTCTTTGAAGACATGACGGCCAATCAGTACGACATGCCCTCCTTTGGAGAGGGC
CTCAACTTTAGCGATGCCTGGCTCGACCTGCCCCCCCAGTTCATGGGCACTGCCACGTCTTTTGGTTCTCACTCT
TCACTCGACTCAACCACCGATCACAGCTTCTCCCCTCCAACCACCAACGGAGCCACCGACAAACAACTGCATCTC
CAAAGGATGATGCCCGACTCCCACCTCATGCCCCCGCCGCCTCCGCCGCCGAACCAGCAACAAATCTACGCCCAG
CAACACTCTGACGAGGTTCTAAACGCTGCTGCTACCCTACTTCAGAATGGCTCCACTCCTCGCACTGTTTCACAC
AAGAGCTGCGACTATTCACACGCACGGAGATCCGTGGGATATCCCGTGGGCCATTTGCGCCACCAGCCCATGGAA
GAATTCAAGGAAGAGAACCGCAGGAGTAGTTTGGGAACCGAAAACGACAGCAACTACTCTGCATGGGTCTGGGGG
ACCAAGGAACGCACCCCTCAGCGCAAGGCACCCCTTCCTGATTTTCAATGGGGTTCCGACTCCAATTTCGGTCCT
GCACAGGGCTATGCTCCCGAAGCAAGTAATGAGTCGTTGGATTGTCTGCAAAAGACACATCTCAAGTGCCTTGAA
TGCTTGGAAGTTACGAATAGTGCCACCAATACAAGCCCAAGCAGCCCTAATAACCATGGGCCATTTGACAACGAG
GGCGATGATTCCATTTACGTCAAGACTGAAGACGATCTCAGTGGCCCGCCACGCAAGAGACGGAAGAGCAAAAAC
TTTCGAGATGCAGGAGACGAAGACGACGAAGACGATTTGGCCGCCGTACGATCTGGCCGAAAGAGAAAGCCAAGA
AGCGAGCGCATTGACACCTCGCCTGCTTCAGACACGCCCGCCAACGGCCGCCGTCGCAAATCTGTCGCCAGCGGC
TCCAAAGTGCCGCGGGAAAACTTGACAGAGGAACAGAAGCGTGAGAACCACATTCGCAGCGAGCAGAAGCGCCGT
ACCCTCATCAAGGAAGGATTTGACGATCTCGGGGAGCTGGTGCCCGGTCTCAAGGGTGGTGGCTTCAGCAAGAGC
ACGACACTGGCCATGGCTGCTGAGTGGCTCGAAGAGCTCTTGCGTGACAATAAGGCTTTGTCTGCACAGTTGGCC
GCTCTGAACGGGCGGTGA
Transcript >OphauG2|6952
ATGCTCGCCATCCAGCAGGCTCCCAGGATGGGTTCATCGCAGCCTGATTCCGAGCCCCTGCTGCCATTTGGCTAT
GCCGTCGACCCAAGTCATGATCTCTTCGATGCGCCCCCAGATCCCGCCCCGGGCGCCCCTCTCCTATCCGAGACT
GATAGCAAGTTTCTCAGCTCCTTCTTTGAAGACATGACGGCCAATCAGTACGACATGCCCTCCTTTGGAGAGGGC
CTCAACTTTAGCGATGCCTGGCTCGACCTGCCCCCCCAGTTCATGGGCACTGCCACGTCTTTTGGTTCTCACTCT
TCACTCGACTCAACCACCGATCACAGCTTCTCCCCTCCAACCACCAACGGAGCCACCGACAAACAACTGCATCTC
CAAAGGATGATGCCCGACTCCCACCTCATGCCCCCGCCGCCTCCGCCGCCGAACCAGCAACAAATCTACGCCCAG
CAACACTCTGACGAGGTTCTAAACGCTGCTGCTACCCTACTTCAGAATGGCTCCACTCCTCGCACTGTTTCACAC
AAGAGCTGCGACTATTCACACGCACGGAGATCCGTGGGATATCCCGTGGGCCATTTGCGCCACCAGCCCATGGAA
GAATTCAAGGAAGAGAACCGCAGGAGTAGTTTGGGAACCGAAAACGACAGCAACTACTCTGCATGGGTCTGGGGG
ACCAAGGAACGCACCCCTCAGCGCAAGGCACCCCTTCCTGATTTTCAATGGGGTTCCGACTCCAATTTCGGTCCT
GCACAGGGCTATGCTCCCGAAGCAAGTAATGAGTCGTTGGATTGTCTGCAAAAGACACATCTCAAGTGCCTTGAA
TGCTTGGAAGTTACGAATAGTGCCACCAATACAAGCCCAAGCAGCCCTAATAACCATGGGCCATTTGACAACGAG
GGCGATGATTCCATTTACGTCAAGACTGAAGACGATCTCAGTGGCCCGCCACGCAAGAGACGGAAGAGCAAAAAC
TTTCGAGATGCAGGAGACGAAGACGACGAAGACGATTTGGCCGCCGTACGATCTGGCCGAAAGAGAAAGCCAAGA
AGCGAGCGCATTGACACCTCGCCTGCTTCAGACACGCCCGCCAACGGCCGCCGTCGCAAATCTGTCGCCAGCGGC
TCCAAAGTGCCGCGGGAAAACTTGACAGAGGAACAGAAGCGTGAGAACCACATTCGCAGCGAGCAGAAGCGCCGT
ACCCTCATCAAGGAAGGATTTGACGATCTCGGGGAGCTGGTGCCCGGTCTCAAGGGTGGTGGCTTCAGCAAGAGC
ACGACACTGGCCATGGCTGCTGAGTGGCTCGAAGAGCTCTTGCGTGACAATAAGGCTTTGTCTGCACAGTTGGCC
GCTCTGAACGGGCGGTGA
Gene >OphauG2|6952
ATGCTCGCCATCCAGCAGGCTCCCAGGATGGGTTCATCGCAGCCTGATTCCGAGCCCCTGCTGCCATTTGGCTGT
ACGTCTCTCCCCGTTGCCTCGCCTGCCCTGCCCCCGAGAAATCAGAGACACCATCCGCTGACACGCCACCTACTG
TAGATGCCGTCGACCCAAGTCATGATCTCTTCGATGCGCCCCCAGATCCCGCCCCGGGCGCCCCTCTCCTATCCG
AGACTGATAGCAAGTTTCTCAGCTCCTTCTTTGAAGACATGACGGCCAATCAGTACGACATGCCCTCCTTTGGAG
AGGGCCTCAACTTTAGCGATGCCTGGCTCGACCTGCCCCCCCAGTTCATGGGCACTGCCACGTCTTTTGGTTCTC
ACTCTTCACTCGACTCAACCACCGATCACAGCTTCTCCCCTCCAACCACCAACGGAGCCACCGACAAACAACTGC
ATCTCCAAAGGATGATGCCCGACTCCCACCTCATGCCCCCGCCGCCTCCGCCGCCGAACCAGCAACAAATCTACG
CCCAGCAACACTCTGACGAGGTTCTAAACGCTGCTGCTACCCTACTTCAGAATGGCTCCACTCCTCGCACTGTTT
CACACAAGAGCTGCGACTATTCACACGCACGGAGATCCGTGGGATATCCCGTGGGCCATTTGCGCCACCAGCCCA
TGGAAGAATTCAAGGAAGAGAACCGCAGGAGTAGTTTGGGAACCGAAAACGACAGCAACTACTCTGCATGGGTCT
GGGGGACCAAGGAACGCACCCCTCAGCGCAAGGCACCCCTTCCTGATTTTCAATGGGGTTCCGACTCCAATTTCG
GTCCTGCACAGGGCTATGCTCCCGAAGCAAGTAATGAGTCGTTGGATTGTCTGCAAAAGACACATCTCAAGTGCC
TTGAATGCTTGGAAGTTACGAATAGTGCCACCAATACAAGCCCAAGCAGCCCTAATAACCATGGGCCATTTGACA
ACGAGGGCGATGATTCCATTTACGTCAAGACTGAAGACGATCTCAGTGGCCCGCCACGCAAGAGACGGAAGAGCA
AAAACTTTCGAGATGCAGGAGACGAAGACGACGAAGACGATTTGGCCGCCGTACGATCTGGCCGAAAGAGAAAGC
CAAGAAGCGAGCGCATTGACACCTCGCCTGCTTCAGACACGCCCGCCAACGGCCGCCGTCGCAAATCTGTCGCCA
GCGGCTCCAAAGTGCCGCGGGAAAACTTGACAGAGGAACAGAAGCGTGAGAACCACATTCGCAGCGAGCAGAAGC
GCCGTACCCTCATCAAGGAAGGATTTGACGATCTCGGGGAGCTGGTGCCCGGTCTCAAGGGTGGTGGCTTCAGCA
AGAGCACGACACTGGCCATGGCTGCTGAGTGGCTCGAAGAGCTCTTGCGTGACAATAAGGCTTTGTCTGCACAGT
TGGCCGCTCTGAACGGGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail