Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|695
Gene name
LocationContig_1179:4011..4936
Strand-
Gene length (bp)925
Transcript length (bp)705
Coding sequence length (bp)705
Protein length (aa) 235

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y) 5.7E-35 18 186

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P04803|SYWM_YEAST Tryptophan--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSW1 PE=1 SV=2 1 234 4.0E-46
sp|O42875|SYWM_SCHPO Tryptophan--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msw1 PE=3 SV=1 1 234 2.0E-42
sp|P21656|SYW_BACSU Tryptophan--tRNA ligase OS=Bacillus subtilis (strain 168) GN=trpS PE=1 SV=2 1 234 1.0E-39
sp|Q8EK12|SYW_SHEON Tryptophan--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=trpS PE=3 SV=1 1 234 1.0E-38
sp|Q8R9X8|SYW_CALS4 Tryptophan--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=trpS PE=3 SV=1 13 234 2.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P04803|SYWM_YEAST Tryptophan--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSW1 PE=1 SV=2 1 234 4.0E-46
sp|O42875|SYWM_SCHPO Tryptophan--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msw1 PE=3 SV=1 1 234 2.0E-42
sp|P21656|SYW_BACSU Tryptophan--tRNA ligase OS=Bacillus subtilis (strain 168) GN=trpS PE=1 SV=2 1 234 1.0E-39
sp|Q8EK12|SYW_SHEON Tryptophan--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=trpS PE=3 SV=1 1 234 1.0E-38
sp|Q8R9X8|SYW_CALS4 Tryptophan--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=trpS PE=3 SV=1 13 234 2.0E-37
sp|Q86A90|SYWM_DICDI Tryptophan--tRNA ligase, mitochondrial OS=Dictyostelium discoideum GN=wars2 PE=3 SV=1 1 234 2.0E-37
sp|P00953|SYW_GEOSE Tryptophan--tRNA ligase OS=Geobacillus stearothermophilus GN=trpS PE=1 SV=1 28 234 3.0E-37
sp|Q7NCG8|SYW_GLOVI Tryptophan--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=trpS PE=3 SV=1 20 234 1.0E-36
sp|Q6AGQ7|SYW_LEIXX Tryptophan--tRNA ligase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=trpS PE=3 SV=1 1 234 1.0E-36
sp|Q929H5|SYW_LISIN Tryptophan--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trpS PE=3 SV=1 28 234 1.0E-36
sp|Q8Y577|SYW_LISMO Tryptophan--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trpS PE=3 SV=1 28 234 3.0E-36
sp|Q7MAE0|SYW_WOLSU Tryptophan--tRNA ligase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=trpS PE=3 SV=1 4 234 5.0E-36
sp|Q71XG7|SYW_LISMF Tryptophan--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=trpS PE=3 SV=1 28 234 6.0E-36
sp|Q8XMQ5|SYW_CLOPE Tryptophan--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=trpS PE=3 SV=1 1 234 6.0E-36
sp|Q3T099|SYWM_BOVIN Tryptophan--tRNA ligase, mitochondrial OS=Bos taurus GN=WARS2 PE=2 SV=1 1 234 9.0E-36
sp|Q9ZJX4|SYW_HELPJ Tryptophan--tRNA ligase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trpS PE=3 SV=1 1 234 2.0E-35
sp|Q9AC05|SYW_CAUCR Tryptophan--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=trpS PE=3 SV=1 1 234 2.0E-35
sp|Q9ZD76|SYW_RICPR Tryptophan--tRNA ligase OS=Rickettsia prowazekii (strain Madrid E) GN=trpS PE=3 SV=1 27 234 2.0E-35
sp|Q81TS6|SYW_BACAN Tryptophan--tRNA ligase OS=Bacillus anthracis GN=trpS PE=3 SV=1 28 234 3.0E-35
sp|Q92HR1|SYW_RICCN Tryptophan--tRNA ligase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=trpS PE=3 SV=1 27 234 4.0E-35
sp|Q830U2|SYW_ENTFA Tryptophan--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=trpS PE=3 SV=1 1 234 4.0E-35
sp|P46579|SYWM_CAEEL Tryptophan--tRNA ligase, mitochondrial OS=Caenorhabditis elegans GN=wars-2 PE=2 SV=3 15 234 5.0E-35
sp|Q4UL98|SYW_RICFE Tryptophan--tRNA ligase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=trpS PE=3 SV=1 27 234 7.0E-35
sp|P43835|SYW_HAEIN Tryptophan--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trpS PE=3 SV=1 1 234 7.0E-35
sp|P57956|SYW_PASMU Tryptophan--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=trpS PE=3 SV=1 25 234 8.0E-35
sp|Q8YXE4|SYW_NOSS1 Tryptophan--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trpS PE=3 SV=1 28 233 9.0E-35
sp|Q9KZA7|SYW2_STRCO Tryptophan--tRNA ligase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trpS2 PE=3 SV=1 1 234 1.0E-34
sp|P56396|SYW_HELPY Tryptophan--tRNA ligase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trpS PE=3 SV=2 1 234 1.0E-34
sp|Q82E91|SYW2_STRAW Tryptophan--tRNA ligase 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=trpS2 PE=3 SV=1 1 234 1.0E-34
sp|Q9K8Y2|SYW_BACHD Tryptophan--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=trpS PE=3 SV=1 29 234 1.0E-34
sp|Q891C7|SYW_CLOTE Tryptophan--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=trpS PE=3 SV=1 1 234 1.0E-34
sp|Q7VPB2|SYW_HAEDU Tryptophan--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=trpS PE=3 SV=1 1 234 2.0E-34
sp|Q8DHG3|SYW_THEEB Tryptophan--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=trpS PE=3 SV=1 28 234 2.0E-34
sp|Q8ERU2|SYW_OCEIH Tryptophan--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=trpS PE=3 SV=1 1 234 2.0E-34
sp|Q9UGM6|SYWM_HUMAN Tryptophan--tRNA ligase, mitochondrial OS=Homo sapiens GN=WARS2 PE=1 SV=1 1 234 4.0E-34
sp|Q68WR2|SYW_RICTY Tryptophan--tRNA ligase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=trpS PE=3 SV=1 27 234 1.0E-33
sp|Q83JA5|SYW_SHIFL Tryptophan--tRNA ligase OS=Shigella flexneri GN=trpS PE=3 SV=1 1 234 1.0E-33
sp|Q82HU1|SYW1_STRAW Tryptophan--tRNA ligase 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=trpS1 PE=3 SV=1 1 234 1.0E-33
sp|Q9EYY6|SYW_ENTAE Tryptophan--tRNA ligase OS=Enterobacter aerogenes GN=trpS PE=3 SV=1 1 234 2.0E-33
sp|P00954|SYW_ECOLI Tryptophan--tRNA ligase OS=Escherichia coli (strain K12) GN=trpS PE=1 SV=3 1 234 2.0E-33
sp|Q9CYK1|SYWM_MOUSE Tryptophan--tRNA ligase, mitochondrial OS=Mus musculus GN=Wars2 PE=1 SV=2 1 234 2.0E-33
sp|Q89W91|SYW_BRADU Tryptophan--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=trpS PE=3 SV=1 27 234 2.0E-33
sp|P67588|SYW_ECOL6 Tryptophan--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trpS PE=3 SV=1 1 234 2.0E-33
sp|P67589|SYW_ECO57 Tryptophan--tRNA ligase OS=Escherichia coli O157:H7 GN=trpS PE=3 SV=1 1 234 2.0E-33
sp|P0A2P2|SYW_SALTY Tryptophan--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trpS PE=3 SV=1 1 234 3.0E-33
sp|P0A2P3|SYW_SALTI Tryptophan--tRNA ligase OS=Salmonella typhi GN=trpS PE=3 SV=1 1 234 3.0E-33
sp|Q8CJX0|SYW1_STRCO Tryptophan--tRNA ligase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trpS1 PE=3 SV=1 1 234 3.0E-33
sp|Q8ZJF2|SYW_YERPE Tryptophan--tRNA ligase OS=Yersinia pestis GN=trpS PE=1 SV=2 1 234 7.0E-33
sp|Q9KNV7|SYW_VIBCH Tryptophan--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=trpS PE=1 SV=2 1 234 1.0E-32
sp|Q7NA61|SYW_PHOLL Tryptophan--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=trpS PE=3 SV=1 28 234 1.0E-32
sp|Q8EVV1|SYW_MYCPE Tryptophan--tRNA ligase OS=Mycoplasma penetrans (strain HF-2) GN=trpS PE=3 SV=1 1 234 1.0E-32
sp|Q8CT69|SYW_STAES Tryptophan--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trpS PE=3 SV=1 1 234 2.0E-32
sp|Q97LD6|SYW_CLOAB Tryptophan--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=trpS PE=3 SV=2 28 234 2.0E-32
sp|Q9PQW8|SYW_UREPA Tryptophan--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=trpS PE=3 SV=1 1 228 3.0E-32
sp|Q8RXE9|SYWM_ARATH Tryptophan--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=OVA4 PE=1 SV=1 27 233 3.0E-32
sp|Q5HQH4|SYW_STAEQ Tryptophan--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trpS PE=3 SV=1 1 234 4.0E-32
sp|P59466|SYW_BUCBP Tryptophan--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trpS PE=3 SV=1 1 234 7.0E-32
sp|P9WFT3|SYW_MYCTU Tryptophan--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trpS PE=1 SV=1 1 234 8.0E-32
sp|P9WFT2|SYW_MYCTO Tryptophan--tRNA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trpS PE=3 SV=1 1 234 8.0E-32
sp|P67591|SYW_MYCBO Tryptophan--tRNA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=trpS PE=3 SV=1 1 234 8.0E-32
sp|Q8D1X5|SYW_WIGBR Tryptophan--tRNA ligase OS=Wigglesworthia glossinidia brevipalpis GN=trpS PE=3 SV=1 27 234 2.0E-31
sp|Q7V286|SYW_PROMP Tryptophan--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=trpS PE=3 SV=1 20 234 3.0E-31
sp|Q7VIP6|SYW_HELHP Tryptophan--tRNA ligase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=trpS PE=3 SV=1 1 234 3.0E-31
sp|Q87L13|SYW_VIBPA Tryptophan--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=trpS PE=3 SV=1 1 234 4.0E-31
sp|Q7VBM9|SYW_PROMA Tryptophan--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=trpS PE=3 SV=1 27 234 7.0E-31
sp|Q8K941|SYW_BUCAP Tryptophan--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trpS PE=3 SV=1 1 232 1.0E-30
sp|Q1RIE3|SYW_RICBR Tryptophan--tRNA ligase OS=Rickettsia bellii (strain RML369-C) GN=trpS PE=3 SV=1 27 234 1.0E-30
sp|Q7TV34|SYW_PROMM Tryptophan--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=trpS PE=3 SV=1 25 234 2.0E-30
sp|P73655|SYW_SYNY3 Tryptophan--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trpS PE=3 SV=2 25 234 5.0E-30
sp|Q49901|SYW_MYCLE Tryptophan--tRNA ligase OS=Mycobacterium leprae (strain TN) GN=trpS PE=3 SV=1 27 234 7.0E-30
sp|Q5E2G5|SYW_VIBF1 Tryptophan--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=trpS PE=3 SV=1 25 234 1.0E-29
sp|Q8DCT6|SYW_VIBVU Tryptophan--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=trpS PE=3 SV=1 1 234 1.0E-29
sp|Q7MH15|SYW_VIBVY Tryptophan--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=trpS PE=3 SV=1 1 234 1.0E-29
sp|Q98C31|SYW_RHILO Tryptophan--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=trpS PE=3 SV=1 27 234 2.0E-29
sp|Q6GI89|SYW_STAAR Tryptophan--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=trpS PE=3 SV=1 1 234 5.0E-29
sp|Q92SI9|SYW_RHIME Tryptophan--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=trpS PE=3 SV=1 27 234 7.0E-29
sp|P67594|SYW_STAAW Tryptophan--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=trpS PE=3 SV=1 1 234 9.0E-29
sp|Q6GAT0|SYW_STAAS Tryptophan--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=trpS PE=3 SV=1 1 234 9.0E-29
sp|P67593|SYW_STAAN Tryptophan--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=trpS PE=1 SV=1 1 234 9.0E-29
sp|P67592|SYW_STAAM Tryptophan--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trpS PE=3 SV=1 1 234 9.0E-29
sp|Q5HH88|SYW_STAAC Tryptophan--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=trpS PE=3 SV=1 1 234 9.0E-29
sp|P57602|SYW_BUCAI Tryptophan--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trpS PE=3 SV=1 1 234 2.0E-28
sp|Q83HC3|SYW_TROW8 Tryptophan--tRNA ligase OS=Tropheryma whipplei (strain TW08/27) GN=trpS PE=3 SV=1 28 234 2.0E-28
sp|Q83FN1|SYW_TROWT Tryptophan--tRNA ligase OS=Tropheryma whipplei (strain Twist) GN=trpS PE=3 SV=1 28 234 3.0E-28
sp|Q8NSJ4|SYW_CORGL Tryptophan--tRNA ligase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=trpS PE=3 SV=1 1 234 4.0E-28
sp|Q8UIE8|SYW_AGRFC Tryptophan--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=trpS PE=3 SV=2 1 234 2.0E-27
sp|Q8FRR3|SYW_COREF Tryptophan--tRNA ligase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=trpS PE=3 SV=1 1 234 2.0E-27
sp|Q98PH7|SYW_MYCPU Tryptophan--tRNA ligase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=trpS PE=3 SV=1 1 234 2.0E-27
sp|Q7VRN5|SYW_BLOFL Tryptophan--tRNA ligase OS=Blochmannia floridanus GN=trpS PE=3 SV=1 23 234 5.0E-27
sp|Q7TTU9|SYW_SYNPX Tryptophan--tRNA ligase OS=Synechococcus sp. (strain WH8102) GN=trpS PE=3 SV=1 27 234 4.0E-26
sp|P67587|SYW_BRUSU Tryptophan--tRNA ligase OS=Brucella suis biovar 1 (strain 1330) GN=trpS PE=3 SV=1 27 233 2.0E-25
sp|P67586|SYW_BRUME Tryptophan--tRNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=trpS PE=3 SV=1 27 233 2.0E-25
sp|P47372|SYW_MYCGE Tryptophan--tRNA ligase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=trpS PE=3 SV=1 1 234 6.0E-25
sp|Q7MT94|SYW_PORGI Tryptophan--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=trpS PE=3 SV=1 28 234 8.0E-23
sp|P75510|SYW_MYCPN Tryptophan--tRNA ligase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=trpS PE=1 SV=1 1 234 1.0E-22
sp|O83640|SYW_TREPA Tryptophan--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=trpS PE=3 SV=1 23 234 3.0E-22
sp|Q7NAT8|SYW_MYCGA Tryptophan--tRNA ligase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=trpS PE=3 SV=1 1 150 8.0E-22
sp|Q7W5T6|SYW_BORPA Tryptophan--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=trpS PE=3 SV=1 27 234 2.0E-19
sp|Q7WGI7|SYW_BORBR Tryptophan--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=trpS PE=3 SV=1 27 234 2.0E-19
sp|Q7VZ05|SYW_BORPE Tryptophan--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=trpS PE=3 SV=1 27 234 3.0E-19
sp|Q9Z7A4|SYW_CHLPN Tryptophan--tRNA ligase OS=Chlamydia pneumoniae GN=trpS PE=3 SV=1 25 234 4.0E-18
sp|P67596|SYW_STRR6 Tryptophan--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=trpS PE=3 SV=1 28 234 9.0E-18
sp|P67595|SYW_STRPN Tryptophan--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=trpS PE=3 SV=1 28 234 9.0E-18
sp|Q5HW79|SYW_CAMJR Tryptophan--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=trpS PE=3 SV=1 28 234 3.0E-17
sp|Q9PIB4|SYW_CAMJE Tryptophan--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=trpS PE=1 SV=1 28 234 3.0E-17
sp|Q9CJD1|SYW_LACLA Tryptophan--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=trpS PE=3 SV=1 28 234 4.0E-17
sp|Q8RGA3|SYW_FUSNN Tryptophan--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=trpS PE=3 SV=1 28 234 1.0E-16
sp|Q87WW4|SYW_PSESM Tryptophan--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=trpS PE=3 SV=1 25 234 2.0E-16
sp|Q821H9|SYW_CHLCV Tryptophan--tRNA ligase OS=Chlamydophila caviae (strain GPIC) GN=trpS PE=3 SV=1 25 228 3.0E-16
sp|O67115|SYW_AQUAE Tryptophan--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=trpS PE=3 SV=1 27 167 8.0E-16
sp|Q8PFH5|SYW_XANAC Tryptophan--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=trpS PE=3 SV=1 28 234 1.0E-15
sp|O84589|SYW_CHLTR Tryptophan--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=trpS PE=3 SV=1 28 234 2.0E-15
sp|Q8DRR1|SYW_STRMU Tryptophan--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=trpS PE=3 SV=1 28 234 3.0E-15
sp|Q9JTQ0|SYW_NEIMA Tryptophan--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=trpS PE=3 SV=1 25 234 3.0E-15
sp|Q8DWP7|SYW_STRA5 Tryptophan--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=trpS PE=3 SV=1 28 234 5.0E-15
sp|Q8E2J5|SYW_STRA3 Tryptophan--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=trpS PE=3 SV=1 28 234 5.0E-15
sp|Q9WYW2|SYW_THEMA Tryptophan--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpS PE=1 SV=1 28 234 5.0E-15
sp|Q9JYQ9|SYW_NEIMB Tryptophan--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=trpS PE=3 SV=1 25 234 9.0E-15
sp|Q9RVD6|SYW2_DEIRA Tryptophan--tRNA ligase 2 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=trpS2 PE=1 SV=1 23 234 1.0E-14
sp|Q8P3Z4|SYW_XANCP Tryptophan--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=trpS PE=3 SV=1 28 234 2.0E-14
sp|P0DG61|SYW_STRPQ Tryptophan--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=trpS PE=3 SV=1 28 234 3.0E-14
sp|P67598|SYW_STRP8 Tryptophan--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=trpS PE=3 SV=1 28 234 3.0E-14
sp|Q5X9A2|SYW_STRP6 Tryptophan--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=trpS PE=3 SV=2 28 234 3.0E-14
sp|P0DG60|SYW_STRP3 Tryptophan--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=trpS PE=3 SV=1 28 234 3.0E-14
sp|Q9PJF5|SYW_CHLMU Tryptophan--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=trpS PE=3 SV=1 25 234 6.0E-14
sp|Q46127|SYW_CLOLO Tryptophan--tRNA ligase OS=Clostridium longisporum GN=trpS PE=3 SV=1 28 234 7.0E-14
sp|Q88NA1|SYW_PSEPK Tryptophan--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=trpS PE=3 SV=1 27 234 7.0E-14
sp|Q7UQA4|SYW_RHOBA Tryptophan--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=trpS PE=3 SV=1 28 234 1.0E-13
sp|Q99XH4|SYW_STRP1 Tryptophan--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=trpS PE=3 SV=1 28 234 2.0E-13
sp|Q9RWV7|SYW_DEIRA Tryptophan--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=trpS PE=3 SV=1 1 234 2.0E-13
sp|O51038|SYW_BORBU Tryptophan--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=trpS PE=3 SV=2 28 234 4.0E-13
sp|Q9HVX6|SYW_PSEAE Tryptophan--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trpS PE=3 SV=1 27 234 6.0E-12
sp|Q87B10|SYW_XYLFT Tryptophan--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=trpS PE=3 SV=1 28 133 2.0E-11
sp|Q9PG74|SYW_XYLFA Tryptophan--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=trpS PE=3 SV=1 28 234 2.0E-11
sp|Q8Y0A1|SYW_RALSO Tryptophan--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=trpS PE=3 SV=1 28 73 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0000166 nucleotide binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0006520 cellular amino acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006399 tRNA metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016874 ligase activity No
GO:0043038 amino acid activation No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043039 tRNA aminoacylation No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|695
MTQWKAKLNLPSTSLPNEHQVTSRLKLGLLAYPILQAADVLVHRATHVPVGQDQQQHLEFARECVTNFNNAYGPT
LVPPQTIIPPVCRIMSLTDPMCKMSKSHKSSRSRILITDTPEDIRNKISSALSDSIPGISYDKTSRPAISNLLDI
LSVFDPQQRTSIELAEDVNKTHIRDFKSMVSDAVIQGLAGVRSRFLDLCDSNSTFLDQVEADGAHRARKNAEETM
HLVKVAVGL*
Coding >OphauG2|695
ATGACGCAGTGGAAGGCCAAGCTCAACTTGCCTTCTACCTCGCTACCAAATGAGCACCAGGTCACATCCCGTCTT
AAACTTGGTCTTTTAGCCTACCCTATTTTGCAGGCTGCAGATGTGCTTGTTCATAGAGCAACGCATGTGCCCGTT
GGCCAGGACCAGCAGCAACATCTCGAATTCGCCCGCGAGTGTGTCACAAACTTCAACAACGCCTATGGACCGACT
CTCGTTCCACCTCAAACAATCATTCCTCCTGTCTGTCGTATTATGTCTTTGACTGATCCCATGTGTAAAATGTCC
AAATCACACAAAAGTAGTCGCTCACGCATTCTTATTACGGATACTCCTGAGGATATTCGCAACAAGATATCATCG
GCGCTGTCTGACTCTATACCCGGAATCTCTTACGATAAAACGTCTAGGCCTGCTATTTCCAACCTACTTGATATC
TTGTCTGTCTTCGACCCACAACAGCGCACTTCTATTGAACTCGCTGAAGATGTCAACAAGACCCATATACGAGAT
TTCAAGTCAATGGTATCTGATGCAGTAATCCAGGGACTTGCTGGCGTCCGTTCTCGCTTCCTGGATCTCTGCGAC
TCCAATAGCACTTTTCTGGATCAAGTTGAAGCTGACGGTGCGCACAGGGCACGGAAGAATGCTGAGGAAACAATG
CATCTAGTCAAGGTTGCCGTGGGCCTGTAA
Transcript >OphauG2|695
ATGACGCAGTGGAAGGCCAAGCTCAACTTGCCTTCTACCTCGCTACCAAATGAGCACCAGGTCACATCCCGTCTT
AAACTTGGTCTTTTAGCCTACCCTATTTTGCAGGCTGCAGATGTGCTTGTTCATAGAGCAACGCATGTGCCCGTT
GGCCAGGACCAGCAGCAACATCTCGAATTCGCCCGCGAGTGTGTCACAAACTTCAACAACGCCTATGGACCGACT
CTCGTTCCACCTCAAACAATCATTCCTCCTGTCTGTCGTATTATGTCTTTGACTGATCCCATGTGTAAAATGTCC
AAATCACACAAAAGTAGTCGCTCACGCATTCTTATTACGGATACTCCTGAGGATATTCGCAACAAGATATCATCG
GCGCTGTCTGACTCTATACCCGGAATCTCTTACGATAAAACGTCTAGGCCTGCTATTTCCAACCTACTTGATATC
TTGTCTGTCTTCGACCCACAACAGCGCACTTCTATTGAACTCGCTGAAGATGTCAACAAGACCCATATACGAGAT
TTCAAGTCAATGGTATCTGATGCAGTAATCCAGGGACTTGCTGGCGTCCGTTCTCGCTTCCTGGATCTCTGCGAC
TCCAATAGCACTTTTCTGGATCAAGTTGAAGCTGACGGTGCGCACAGGGCACGGAAGAATGCTGAGGAAACAATG
CATCTAGTCAAGGTTGCCGTGGGCCTGTAA
Gene >OphauG2|695
ATGACGCAGTGGAAGGTCTGTTTGCTCCCCTAACTTTTGAATTGTGAAGTTAGTAGCTAAGCAACGGTGCACTAT
GCGACTGCTTTACCATAGGCCAAGCTCAACTTGCCTTCTACCTCGCTACCAAATGAGCACCAGGTCACATCCCGT
CTTAAACTTGGTCTTTTAGCCTACCCTATTTTGCAGGCTGCAGATGTGCTTGTTCATAGGTATGCAGCATCACTA
GAGACGCACTGCCGCTATCCATCTTTCTTAAACCCTGGCTCATGTACGTCCGGTATATAACAGAGCAACGCATGT
GCCCGTTGGCCAGGACCAGCAGCAACATCTCGAATTCGCCCGCGAGTGTGTCACAAACTTCAACAACGCCTATGG
ACCGACTCTCGTTCCACCTCAAACAATCATTCGTATGTTGGCTTGCATCACATCTTTTATCCATTTGATTTACTG
ATTAGATGCCGCAATCAAAGCTCCTGTCTGTCGTATTATGTCTTTGACTGATCCCATGTGTAAAATGTCCAAATC
ACACAAAAGTAGTCGCTCACGCATTCTTATTACGGATACTCCTGAGGATATTCGCAACAAGATATCATCGGCGCT
GTCTGACTCTATACCCGGAATCTCTTACGATAAAACGTCTAGGCCTGCTATTTCCAACCTACTTGATATCTTGTC
TGTCTTCGACCCACAACAGCGCACTTCTATTGAACTCGCTGAAGATGTCAACAAGACCCATATACGAGATTTCAA
GTCAATGGTATCTGATGCAGTAATCCAGGGACTTGCTGGCGTCCGTTCTCGCTTCCTGGATCTCTGCGACTCCAA
TAGCACTTTTCTGGATCAAGTTGAAGCTGACGGTGCGCACAGGGCACGGAAGAATGCTGAGGAAACAATGCATCT
AGTCAAGGTTGCCGTGGGCCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail