Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6942
Gene name
LocationContig_76:16300..17426
Strand-
Gene length (bp)1126
Transcript length (bp)1008
Coding sequence length (bp)1008
Protein length (aa) 336

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00956 NAP Nucleosome assembly protein (NAP) 3.9E-22 49 275

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9HGN2|YO48_SCHPO Putative nucleosome assembly protein C36B7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36B7.08c PE=1 SV=1 6 142 8.0E-15

GO

GO Term Description Terminal node
GO:0006334 nucleosome assembly Yes
GO:0005634 nucleus Yes
GO:0043227 membrane-bounded organelle No
GO:0065003 protein-containing complex assembly No
GO:0022607 cellular component assembly No
GO:0043933 protein-containing complex organization No
GO:0043226 organelle No
GO:0006338 chromatin remodeling No
GO:0043231 intracellular membrane-bounded organelle No
GO:0008150 biological_process No
GO:0065004 protein-DNA complex assembly No
GO:0034728 nucleosome organization No
GO:0016043 cellular component organization No
GO:0043229 intracellular organelle No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0071824 protein-DNA complex subunit organization No
GO:0071840 cellular component organization or biogenesis No
GO:0110165 cellular anatomical entity No
GO:0006325 chromatin organization No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3295
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6942 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5849
Ophiocordyceps camponoti-floridani Ophcf2|04831
Ophiocordyceps camponoti-rufipedis Ophun1|5855
Ophiocordyceps kimflemingae Ophio5|683
Ophiocordyceps subramaniannii Hirsu2|6066

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6942
MSPEPESSVSYEMLEDLENEFQQVELDLIRHQAKLSNDLYAKREKIVAEIARFWPLVFEASPPDIDEYIQPSDAA
LLLGNLKSLSVERFELQNGDPRSIAIRFEFGDNEHFEDKVLEKKFWWRHAKDGWSGLVSEPIDIKWKSEAKDLTG
GMLGLARRVWQEDCAGKKEVETEAKKQLKDKMSRTGLGGVSFFAWFGFRGRDVSAAENTKALKAEQEKRQARKEG
KAKDQDENDGHDQDAHQDDEYNLEIFPTADDLAIAIAEDLWPNAIKYFTQAQEQDVASDAWFESDGGEEEQDEAN
GQDEDGDEDGDGYEDEDEDEEDEADQGPPQKKRKA*
Coding >OphauG2|6942
ATGTCGCCAGAACCTGAAAGCTCTGTTAGCTACGAGATGCTCGAGGACCTTGAAAACGAGTTTCAACAGGTCGAG
CTTGATTTGATCCGCCACCAGGCCAAGCTCAGCAACGATCTCTACGCCAAACGAGAAAAGATTGTTGCCGAAATC
GCCCGCTTCTGGCCCCTTGTATTCGAAGCATCACCGCCAGACATTGACGAGTATATCCAGCCCTCAGACGCAGCA
CTACTACTTGGCAACCTCAAGTCACTCTCAGTCGAGCGCTTCGAGCTACAAAACGGCGACCCGCGTAGCATTGCC
ATTCGCTTCGAGTTTGGAGACAATGAGCACTTTGAGGACAAGGTATTGGAAAAAAAGTTTTGGTGGCGCCACGCA
AAGGATGGCTGGTCGGGCCTAGTCAGCGAGCCCATCGACATCAAGTGGAAGAGCGAGGCCAAGGATCTGACGGGC
GGCATGTTGGGTCTTGCGCGCCGAGTCTGGCAAGAGGACTGCGCTGGAAAAAAAGAGGTTGAGACCGAGGCCAAG
AAGCAGCTCAAGGACAAGATGAGCAGGACGGGGCTTGGCGGCGTAAGCTTCTTTGCCTGGTTCGGCTTCCGCGGG
CGAGACGTCTCGGCCGCCGAGAACACCAAGGCGCTCAAGGCGGAGCAGGAGAAGCGTCAGGCGCGCAAGGAGGGC
AAAGCCAAGGACCAAGACGAAAATGACGGCCACGACCAAGACGCGCATCAGGACGACGAGTACAACCTCGAGATT
TTCCCTACCGCTGACGACTTGGCCATTGCCATTGCCGAGGACCTGTGGCCCAATGCCATTAAGTATTTCACACAA
GCCCAGGAACAAGATGTTGCGAGCGATGCTTGGTTCGAGTCGGACGGTGGAGAAGAAGAGCAGGATGAGGCAAAT
GGGCAAGACGAGGACGGGGACGAGGACGGGGACGGGTACGAAGACGAGGACGAGGACGAGGAAGACGAGGCTGAC
CAAGGGCCTCCGCAAAAGAAGCGCAAGGCGTAA
Transcript >OphauG2|6942
ATGTCGCCAGAACCTGAAAGCTCTGTTAGCTACGAGATGCTCGAGGACCTTGAAAACGAGTTTCAACAGGTCGAG
CTTGATTTGATCCGCCACCAGGCCAAGCTCAGCAACGATCTCTACGCCAAACGAGAAAAGATTGTTGCCGAAATC
GCCCGCTTCTGGCCCCTTGTATTCGAAGCATCACCGCCAGACATTGACGAGTATATCCAGCCCTCAGACGCAGCA
CTACTACTTGGCAACCTCAAGTCACTCTCAGTCGAGCGCTTCGAGCTACAAAACGGCGACCCGCGTAGCATTGCC
ATTCGCTTCGAGTTTGGAGACAATGAGCACTTTGAGGACAAGGTATTGGAAAAAAAGTTTTGGTGGCGCCACGCA
AAGGATGGCTGGTCGGGCCTAGTCAGCGAGCCCATCGACATCAAGTGGAAGAGCGAGGCCAAGGATCTGACGGGC
GGCATGTTGGGTCTTGCGCGCCGAGTCTGGCAAGAGGACTGCGCTGGAAAAAAAGAGGTTGAGACCGAGGCCAAG
AAGCAGCTCAAGGACAAGATGAGCAGGACGGGGCTTGGCGGCGTAAGCTTCTTTGCCTGGTTCGGCTTCCGCGGG
CGAGACGTCTCGGCCGCCGAGAACACCAAGGCGCTCAAGGCGGAGCAGGAGAAGCGTCAGGCGCGCAAGGAGGGC
AAAGCCAAGGACCAAGACGAAAATGACGGCCACGACCAAGACGCGCATCAGGACGACGAGTACAACCTCGAGATT
TTCCCTACCGCTGACGACTTGGCCATTGCCATTGCCGAGGACCTGTGGCCCAATGCCATTAAGTATTTCACACAA
GCCCAGGAACAAGATGTTGCGAGCGATGCTTGGTTCGAGTCGGACGGTGGAGAAGAAGAGCAGGATGAGGCAAAT
GGGCAAGACGAGGACGGGGACGAGGACGGGGACGGGTACGAAGACGAGGACGAGGACGAGGAAGACGAGGCTGAC
CAAGGGCCTCCGCAAAAGAAGCGCAAGGCGTAA
Gene >OphauG2|6942
ATGTCGCCAGAACCTGAAAGCTCTGTTAGCTACGAGATGCTCGAGGACCTTGAAAACGAGTTTCAACAGGTCGAG
CTTGATTTGAGTAAGACTTGGAGGGAGTGAGAGAGACATGGGCGACTGACAAGACACACACAGTCCGCCACCAGG
CCAAGCTCAGCAACGATCTCTACGCCAAACGAGAAAAGATTGTTGCCGAAATCGCCCGCTTCTGGCCCCTTGTAT
TCGAAGCATCACCGCCAGACATTGACGAGTATATCCAGCCCTCAGACGCAGCACTACTACTTGGCAACCTCAAGT
CACTCTCAGTCGAGCGCTTCGAGCTACAAAACGGCGACCCGCGTAGCATTGCCATTCGCTTCGAGTTTGGAGACA
ATGAGCACTTTGAGGACAAGGTATTGGAAAAAAAGTTTTGGTGGCGCCACGCAAAGGATGGCTGGTCGGGCCTAG
TCAGCGAGCCCATCGACATCAAGTGGAAGAGCGAGGCCAAGGATCTGACGGGCGGCATGTTGGGTCTTGCGCGCC
GAGTCTGGCAAGAGGACTGCGCTGGAAAAAAAGAGGTTGAGACCGAGGCCAAGAAGCAGCTCAAGGACAAGATGA
GCAGGACGGGGCTTGGCGGCGTAAGCTTCTTTGCCTGGTTCGGCTTCCGCGGGCGAGACGTCTCGGCCGCCGAGA
ACACCAAGGCGCTCAAGGCGGAGCAGGAGAAGCGTCAGGCGCGCAAGGAGGGCAAAGCCAAGGACCAAGACGAAA
ATGACGGCCACGACCAAGACGCGCATCAGGACGACGAGTACAACCTCGAGATTTTCCCTACCGCTGACGACTTGG
CCATTGCCATTGCCGAGGACCTGTGGCCCAATGCCATTAAGTATTTCAGTGAGTCGAGACGCTCGAGACTGACTC
TGCGTGGGTGCAAAGGCAACTAAAAGCTCCTTGTGCAGCACAAGCCCAGGAACAAGATGTTGCGAGCGATGCTTG
GTTCGAGTCGGACGGTGGAGAAGAAGAGCAGGATGAGGCAAATGGGCAAGACGAGGACGGGGACGAGGACGGGGA
CGGGTACGAAGACGAGGACGAGGACGAGGAAGACGAGGCTGACCAAGGGCCTCCGCAAAAGAAGCGCAAGGCGTA
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail