Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6941
Gene name
LocationContig_76:14072..15452
Strand-
Gene length (bp)1380
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14027 Questin_oxidase Questin oxidase-like 9.4E-38 8 208

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6UEF1|AFLY_ASPPA Oxidoreductase AflY OS=Aspergillus parasiticus GN=aflY PE=4 SV=1 9 341 1.0E-25

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup405
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6941 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5850
Ophiocordyceps camponoti-floridani Ophcf2|04830
Ophiocordyceps camponoti-rufipedis Ophun1|5854
Ophiocordyceps kimflemingae Ophio5|5164
Ophiocordyceps kimflemingae Ophio5|682
Ophiocordyceps subramaniannii Hirsu2|2221
Ophiocordyceps subramaniannii Hirsu2|2825

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6941
MIEAFTTTRAHLGQAADYASFVRFFQDGISQRGGDAAAVAHDFLFAQLPQPPRGGMLARLFSGLVHPLLQLLYGL
EWAQPAIVAAALAQAAVHPSEVGDCMVDVDEYARDNQQLEAASVLDLCRHLHTRGGPLAQLTNWHDMGVNYIGKM
VRLGGQDLLALLARIRVDPNSDLDEATAHLVHSAAYLVAAAAWHPPQKPTFDFFLMQVASPSSTTLLLLLLIEYI
ARGCPALRLDDALRDWSAPTSMAAPSPRHLLSRLLLTADDGHVVKTARALVVASDLSRKWHGRSWIRIAGDDAWV
KVMQMLLSTVDRRDDQWLCDGKQWVRGAGFQEAWQAVPIME*
Coding >OphauG2|6941
ATGATCGAGGCTTTCACGACCACCCGCGCGCACCTCGGCCAAGCTGCCGACTATGCGTCCTTTGTCCGCTTCTTC
CAAGACGGCATCTCCCAGCGCGGCGGCGACGCAGCGGCAGTGGCGCACGACTTCCTCTTTGCCCAGCTGCCGCAG
CCGCCCCGTGGCGGCATGCTGGCGCGCCTGTTTAGCGGCCTCGTCCACCCGCTGCTACAGCTGCTCTATGGGCTC
GAGTGGGCGCAGCCGGCCATTGTCGCTGCCGCCCTGGCCCAGGCGGCCGTGCATCCGAGCGAGGTTGGCGACTGC
ATGGTTGACGTGGATGAGTATGCCCGAGACAACCAGCAGCTGGAAGCCGCCTCAGTCCTGGACTTGTGTCGCCAC
CTGCATACTCGTGGCGGGCCCTTGGCTCAACTGACCAACTGGCATGACATGGGCGTCAACTATATTGGCAAGATG
GTGCGCCTCGGCGGCCAAGATCTGCTTGCCCTGCTTGCCCGCATCCGCGTCGACCCCAACAGCGACCTCGACGAG
GCCACCGCCCACCTCGTTCACTCGGCTGCCTACCTCGTCGCCGCTGCCGCCTGGCATCCTCCTCAAAAGCCCACC
TTTGACTTTTTCCTCATGCAAGTCGCCTCCCCCTCTTCAACAACTCTCCTCCTCCTCCTCCTCATCGAGTACATT
GCCCGTGGCTGTCCCGCCCTGCGCCTCGACGACGCCCTGCGCGACTGGTCCGCCCCGACCAGCATGGCTGCCCCC
AGCCCCCGCCATCTGCTCTCGCGCCTCCTGCTCACTGCTGACGATGGCCATGTCGTCAAGACGGCCCGTGCTCTC
GTCGTGGCCAGCGACTTGTCTCGCAAGTGGCACGGTCGCTCCTGGATCCGCATCGCCGGCGATGATGCCTGGGTC
AAGGTGATGCAGATGCTGCTGAGCACTGTCGACCGTCGTGACGACCAGTGGCTGTGCGACGGAAAGCAGTGGGTG
CGCGGCGCCGGCTTCCAAGAGGCGTGGCAAGCGGTGCCAATTATGGAGTAG
Transcript >OphauG2|6941
ATGATCGAGGCTTTCACGACCACCCGCGCGCACCTCGGCCAAGCTGCCGACTATGCGTCCTTTGTCCGCTTCTTC
CAAGACGGCATCTCCCAGCGCGGCGGCGACGCAGCGGCAGTGGCGCACGACTTCCTCTTTGCCCAGCTGCCGCAG
CCGCCCCGTGGCGGCATGCTGGCGCGCCTGTTTAGCGGCCTCGTCCACCCGCTGCTACAGCTGCTCTATGGGCTC
GAGTGGGCGCAGCCGGCCATTGTCGCTGCCGCCCTGGCCCAGGCGGCCGTGCATCCGAGCGAGGTTGGCGACTGC
ATGGTTGACGTGGATGAGTATGCCCGAGACAACCAGCAGCTGGAAGCCGCCTCAGTCCTGGACTTGTGTCGCCAC
CTGCATACTCGTGGCGGGCCCTTGGCTCAACTGACCAACTGGCATGACATGGGCGTCAACTATATTGGCAAGATG
GTGCGCCTCGGCGGCCAAGATCTGCTTGCCCTGCTTGCCCGCATCCGCGTCGACCCCAACAGCGACCTCGACGAG
GCCACCGCCCACCTCGTTCACTCGGCTGCCTACCTCGTCGCCGCTGCCGCCTGGCATCCTCCTCAAAAGCCCACC
TTTGACTTTTTCCTCATGCAAGTCGCCTCCCCCTCTTCAACAACTCTCCTCCTCCTCCTCCTCATCGAGTACATT
GCCCGTGGCTGTCCCGCCCTGCGCCTCGACGACGCCCTGCGCGACTGGTCCGCCCCGACCAGCATGGCTGCCCCC
AGCCCCCGCCATCTGCTCTCGCGCCTCCTGCTCACTGCTGACGATGGCCATGTCGTCAAGACGGCCCGTGCTCTC
GTCGTGGCCAGCGACTTGTCTCGCAAGTGGCACGGTCGCTCCTGGATCCGCATCGCCGGCGATGATGCCTGGGTC
AAGGTGATGCAGATGCTGCTGAGCACTGTCGACCGTCGTGACGACCAGTGGCTGTGCGACGGAAAGCAGTGGGTG
CGCGGCGCCGGCTTCCAAGAGGCGTGGCAAGCGGTGCCAATTATGGAGTAG
Gene >OphauG2|6941
ATGATCGAGGCTTTCACGACCACGTAACTCTCGCCCCTCCCCCCAGACGCTTTACGGTTTTGCTCACAAGCCCAG
ATTGTCCACCACCTCCTCACTCTCTACGGCTGTGGCGCTCAAGCTCCCGCCCTCCGCGCCGCCTACCAAGCCAAC
CACGTCCTCCAGCGTCCGGCCGGCCACGCCTCGGCCTCGCTCGTTGCCGCCCTGCACGCCGACTGGCCGACGACA
AGCCGCGCGCACCTCGGCCAAGCTGCCGACTATGCGTCCTTTGTCCGCTTCTTCCAAGACGGCATCTCCCAGCGC
GGCGGCGACGCAGCGGCAGTGGCGCACGACTTCCTCTTTGCCCAGCTGCCGCAGCCGCCCCGTGGCGGCATGCTG
GCGCGCCTGTTTAGCGGCCTCGTCCACCCGCTGCTACAGCTGCTCTATGGGCTCGAGTGGGCGCAGCCGGCCATT
GTCGCTGCCGCCCTGGCCCAGGCGGCCGTGCATCCGAGCGAGGTTGGCGACTGCATGGTTGACGTGGATGAGTAT
GCCCGAGACAACCAGCAGCTGGAAGCCGCCTCAGTCCTGGACTTGTGTCGCCACCTGCATACTCGTGGCGGGCCC
TTGGCTCAACTGACCAACTGGCATGACATGGGCGTCAACTATATTGGCAAGATGGTGCGCCTCGGCGGCCAAGAT
CTGCTTGCCCTGCTTGCCCGCATCCGCGTCGACCCCAACAGCGACCTCGACGAGGCCACCGCCCACCTCGTTCAC
TCGGCTGCCTACCTCGTCGCCGCTGCCGCCTGGCATCCTCCTCAAAAGCCCACCTTTGACTTTTTCCTCATGCAA
GTCGCCTCCCCCTCTTCAACAACTCTCCTCCTCCTCCTCCGTGCAGCCTCGGTATAACCTCGAGACACCCTCAAC
TGACACCCTCCTTTCTCCAGCCACCTCCTCACCTCGTCCCTCTTCTTCCTCTCTCTGCCTCCCCTCAGCCCCGCC
GCCCGCGCCCGCCTCATCGAGTGGCACCTCCGCGTGCAAGTCATCGAGTACATTGCCCGTGGCTGTCCCGCCCTG
CGCCTCGACGACGCCCTGCGCGACTGGTCCGCCCCGACCAGCATGGCTGCCCCCAGCCCCCGCCATCTGCTCTCG
CGCCTCCTGCTCACTGCTGACGATGGCCATGTCGTCAAGACGGCCCGTGCTCTCGTCGTGGCCAGCGACTTGTCT
CGCAAGTGGCACGGTCGCTCCTGGATCCGCATCGCCGGCGATGATGCCTGGGTCAAGGTGATGCAGATGCTGCTG
AGCACTGTCGACCGTCGTGACGACCAGTGGCTGTGCGACGGAAAGCAGTGGGTGCGCGGCGCCGGCTTCCAAGAG
GCGTGGCAAGCGGTGCCAATTATGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail