Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6939
Gene name
LocationContig_76:9164..10486
Strand-
Gene length (bp)1322
Transcript length (bp)1158
Coding sequence length (bp)1158
Protein length (aa) 386

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00735 Septin Septin 8.2E-115 28 303
PF01926 MMR_HSR1 50S ribosome-binding GTPase 4.4E-07 34 162

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P48009|SPN4_SCHPO Septin homolog spn4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn4 PE=1 SV=1 7 378 2.0E-170
sp|P32468|CDC12_YEAST Cell division control protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC12 PE=1 SV=1 13 375 6.0E-150
sp|Q09883|SPN6_SCHPO Septin homolog spn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn6 PE=1 SV=1 18 384 3.0E-99
sp|Q6GLZ5|SEPT7_XENLA Septin-7 OS=Xenopus laevis GN=sept7 PE=2 SV=1 12 318 5.0E-93
sp|Q9WVC0|SEPT7_RAT Septin-7 OS=Rattus norvegicus GN=Sept7 PE=1 SV=1 12 366 8.0E-93
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P48009|SPN4_SCHPO Septin homolog spn4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn4 PE=1 SV=1 7 378 2.0E-170
sp|P32468|CDC12_YEAST Cell division control protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC12 PE=1 SV=1 13 375 6.0E-150
sp|Q09883|SPN6_SCHPO Septin homolog spn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn6 PE=1 SV=1 18 384 3.0E-99
sp|Q6GLZ5|SEPT7_XENLA Septin-7 OS=Xenopus laevis GN=sept7 PE=2 SV=1 12 318 5.0E-93
sp|Q9WVC0|SEPT7_RAT Septin-7 OS=Rattus norvegicus GN=Sept7 PE=1 SV=1 12 366 8.0E-93
sp|Q5R481|SEPT7_PONAB Septin-7 OS=Pongo abelii GN=SEPT7 PE=2 SV=2 12 366 2.0E-92
sp|Q16181|SEPT7_HUMAN Septin-7 OS=Homo sapiens GN=SEPT7 PE=1 SV=2 12 366 2.0E-92
sp|Q6Q137|SEPT7_BOVIN Septin-7 OS=Bos taurus GN=SEPT7 PE=2 SV=2 12 366 2.0E-92
sp|O55131|SEPT7_MOUSE Septin-7 OS=Mus musculus GN=Sept7 PE=1 SV=1 12 366 2.0E-92
sp|Q5R1W1|SEPT7_PANTR Septin-7 (Fragment) OS=Pan troglodytes GN=SEPT7 PE=2 SV=2 12 318 2.0E-92
sp|P28661|SEPT4_MOUSE Septin-4 OS=Mus musculus GN=Sept4 PE=1 SV=1 12 301 5.0E-91
sp|Q5R6R7|SEPT4_PONAB Septin-4 OS=Pongo abelii GN=SEPT4 PE=2 SV=1 12 301 7.0E-91
sp|Q4R4X5|SEPT4_MACFA Septin-4 OS=Macaca fascicularis GN=SEPT4 PE=2 SV=1 12 301 8.0E-91
sp|O43236|SEPT4_HUMAN Septin-4 OS=Homo sapiens GN=SEPT4 PE=1 SV=1 12 301 2.0E-90
sp|Q5ZMH1|SEPT2_CHICK Septin-2 OS=Gallus gallus GN=SEPT2 PE=2 SV=1 6 332 4.0E-90
sp|P42207|SEPT1_DROME Septin-1 OS=Drosophila melanogaster GN=Sep1 PE=1 SV=1 4 299 4.0E-90
sp|Q9Z2Q6|SEPT5_MOUSE Septin-5 OS=Mus musculus GN=Sept5 PE=1 SV=2 12 308 9.0E-90
sp|Q5BKN4|SEP2A_XENTR Septin-2A OS=Xenopus tropicalis GN=sept2-A PE=2 SV=1 6 332 1.0E-89
sp|Q9JJM9|SEPT5_RAT Septin-5 OS=Rattus norvegicus GN=Sept5 PE=1 SV=2 12 308 1.0E-89
sp|Q99719|SEPT5_HUMAN Septin-5 OS=Homo sapiens GN=SEPT5 PE=1 SV=1 12 308 2.0E-89
sp|P40797|PNUT_DROME Protein peanut OS=Drosophila melanogaster GN=pnut PE=1 SV=2 7 358 2.0E-89
sp|Q9BGQ3|SEPT5_MACFA Septin-5 OS=Macaca fascicularis GN=Sept5 PE=2 SV=1 12 308 1.0E-88
sp|Q0VC68|SEPT5_BOVIN Septin-5 OS=Bos taurus GN=SEPT5 PE=2 SV=1 12 308 1.0E-88
sp|Q15019|SEPT2_HUMAN Septin-2 OS=Homo sapiens GN=SEPT2 PE=1 SV=1 7 299 6.0E-88
sp|Q5RA66|SEPT2_PONAB Septin-2 OS=Pongo abelii GN=SEPT2 PE=2 SV=1 7 299 7.0E-88
sp|Q2NKY7|SEPT2_BOVIN Septin-2 OS=Bos taurus GN=SEPT2 PE=2 SV=1 7 326 2.0E-87
sp|Q91Y81|SEPT2_RAT Septin-2 OS=Rattus norvegicus GN=Sept2 PE=1 SV=1 7 299 2.0E-87
sp|A1L0Y5|SEP2B_XENTR Septin-2B OS=Xenopus tropicalis GN=sept2-B PE=2 SV=1 7 332 3.0E-87
sp|Q6ZU15|SEP14_HUMAN Septin-14 OS=Homo sapiens GN=SEPT14 PE=1 SV=2 12 371 3.0E-87
sp|P42208|SEPT2_MOUSE Septin-2 OS=Mus musculus GN=Sept2 PE=1 SV=2 7 299 5.0E-87
sp|P39826|CDC3_CANAX Cell division control protein 3 OS=Candida albicans GN=CDC3 PE=3 SV=1 12 368 9.0E-87
sp|Q63ZQ1|SEP2B_XENLA Septin-2B OS=Xenopus laevis GN=sept2-b PE=2 SV=1 7 337 1.0E-86
sp|Q9DE33|SEP2A_XENLA Septin-2A OS=Xenopus laevis GN=sept2-a PE=1 SV=1 7 299 4.0E-86
sp|B2KIE9|SEPT8_RHIFE Septin-8 OS=Rhinolophus ferrumequinum GN=SEPT8 PE=3 SV=1 3 342 9.0E-85
sp|Q8CHH9|SEPT8_MOUSE Septin-8 OS=Mus musculus GN=Sept8 PE=1 SV=4 3 342 2.0E-84
sp|A4FUM1|SEP8B_DANRE Septin-8-B OS=Danio rerio GN=sept8b PE=2 SV=1 12 371 2.0E-84
sp|B1MTN8|SEPT8_CALMO Septin-8 OS=Callicebus moloch GN=SEPT8 PE=3 SV=1 3 342 5.0E-84
sp|A5PJU9|SEPT1_BOVIN Septin-1 OS=Bos taurus GN=SEPT1 PE=2 SV=1 12 370 5.0E-84
sp|Q0VCP4|SEPT8_BOVIN Septin-8 OS=Bos taurus GN=SEPT8 PE=2 SV=3 3 341 8.0E-84
sp|Q9DA97|SEP14_MOUSE Septin-14 OS=Mus musculus GN=Sept14 PE=1 SV=3 12 359 8.0E-84
sp|B0BNF1|SEPT8_RAT Septin-8 OS=Rattus norvegicus GN=Sept8 PE=1 SV=1 3 341 9.0E-84
sp|B0KWP7|SEPT8_CALJA Septin-8 OS=Callithrix jacchus GN=SEPT8 PE=3 SV=1 3 341 9.0E-84
sp|Q8WYJ6|SEPT1_HUMAN Septin-1 OS=Homo sapiens GN=SEPT1 PE=1 SV=2 12 310 2.0E-83
sp|B5FW69|SEPT8_OTOGA Septin-8 OS=Otolemur garnettii GN=SEPT8 PE=3 SV=1 3 341 2.0E-83
sp|Q92599|SEPT8_HUMAN Septin-8 OS=Homo sapiens GN=SEPT8 PE=1 SV=4 3 341 6.0E-83
sp|Q6IRQ5|SEP8B_XENLA Septin-8-B OS=Xenopus laevis GN=sept8-b PE=2 SV=1 12 372 8.0E-83
sp|Q642H3|SEP8A_DANRE Septin-8-A OS=Danio rerio GN=sept8a PE=2 SV=2 12 371 1.0E-82
sp|Q9Z1S5|SEPT3_MOUSE Neuronal-specific septin-3 OS=Mus musculus GN=Sept3 PE=1 SV=2 12 299 2.0E-82
sp|B1H120|SEPT8_XENTR Septin-8 OS=Xenopus tropicalis GN=sept8 PE=2 SV=1 12 372 4.0E-82
sp|Q6AXA6|SEP8A_XENLA Septin-8-A OS=Xenopus laevis GN=sept8-a PE=2 SV=1 12 372 4.0E-82
sp|Q9UH03|SEPT3_HUMAN Neuronal-specific septin-3 OS=Homo sapiens GN=SEPT3 PE=1 SV=3 12 299 4.0E-82
sp|Q2KJB1|SEP10_BOVIN Septin-10 OS=Bos taurus GN=SEPT10 PE=2 SV=1 2 358 5.0E-82
sp|Q9WU34|SEPT3_RAT Neuronal-specific septin-3 OS=Rattus norvegicus GN=Sept3 PE=1 SV=2 12 299 5.0E-82
sp|A2VE99|SEP11_BOVIN Septin-11 OS=Bos taurus GN=SEPT11 PE=2 SV=1 12 341 1.0E-81
sp|Q9NVA2|SEP11_HUMAN Septin-11 OS=Homo sapiens GN=SEPT11 PE=1 SV=3 12 341 1.0E-81
sp|Q09116|SPN2_SCHPO Septin homolog spn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn2 PE=1 SV=2 2 315 2.0E-81
sp|B3GNI6|SEP11_RAT Septin-11 OS=Rattus norvegicus GN=Sept11 PE=1 SV=1 12 341 2.0E-81
sp|Q8C1B7|SEP11_MOUSE Septin-11 OS=Mus musculus GN=Sept11 PE=1 SV=4 12 341 2.0E-81
sp|P42209|SEPT1_MOUSE Septin-1 OS=Mus musculus GN=Sept1 PE=1 SV=2 12 310 3.0E-81
sp|Q08DM7|SEPT3_BOVIN Neuronal-specific septin-3 OS=Bos taurus GN=SEPT3 PE=2 SV=3 12 299 4.0E-81
sp|Q5EB96|SEPT1_RAT Septin-1 OS=Rattus norvegicus GN=Sept1 PE=1 SV=1 12 310 4.0E-81
sp|Q5R8U3|SEP11_PONAB Septin-11 OS=Pongo abelii GN=SEPT11 PE=2 SV=3 12 341 7.0E-81
sp|Q14141|SEPT6_HUMAN Septin-6 OS=Homo sapiens GN=SEPT6 PE=1 SV=4 9 341 1.0E-80
sp|Q9R1T4|SEPT6_MOUSE Septin-6 OS=Mus musculus GN=Sept6 PE=1 SV=4 9 341 1.0E-80
sp|Q3SZN0|SEPT6_BOVIN Septin-6 OS=Bos taurus GN=SEPT6 PE=2 SV=1 9 342 1.0E-80
sp|Q5REG8|SEP10_PONAB Septin-10 OS=Pongo abelii GN=SEPT10 PE=2 SV=1 12 358 2.0E-80
sp|Q4R555|SEP11_MACFA Septin-11 OS=Macaca fascicularis GN=SEPT11 PE=2 SV=3 12 341 2.0E-80
sp|Q9P0V9|SEP10_HUMAN Septin-10 OS=Homo sapiens GN=SEPT10 PE=1 SV=2 12 358 4.0E-80
sp|Q80UG5|SEPT9_MOUSE Septin-9 OS=Mus musculus GN=Sept9 PE=1 SV=1 2 299 8.0E-80
sp|Q9QZR6|SEPT9_RAT Septin-9 OS=Rattus norvegicus GN=Sept9 PE=1 SV=1 2 299 1.0E-79
sp|A2BGU8|SEPT3_DANRE Neuronal-specific septin-3 OS=Danio rerio GN=sept3 PE=2 SV=1 12 299 1.0E-79
sp|Q9UHD8|SEPT9_HUMAN Septin-9 OS=Homo sapiens GN=SEPT9 PE=1 SV=2 2 299 3.0E-79
sp|Q8C650|SEP10_MOUSE Septin-10 OS=Mus musculus GN=Sept10 PE=1 SV=1 3 359 7.0E-79
sp|A6QQL3|SEP14_BOVIN Septin-14 OS=Bos taurus GN=SEPT14 PE=2 SV=1 22 359 2.0E-78
sp|P54359|SEPT2_DROME Septin-2 OS=Drosophila melanogaster GN=Sep2 PE=2 SV=2 12 356 3.0E-78
sp|Q5PQK1|SEP10_RAT Septin-10 OS=Rattus norvegicus GN=Sept10 PE=1 SV=1 12 359 3.0E-77
sp|P41901|SPR3_YEAST Sporulation-regulated protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPR3 PE=1 SV=1 12 383 1.0E-76
sp|O36023|SPN1_SCHPO Septin homolog spn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn1 PE=1 SV=2 12 385 1.0E-76
sp|P25342|CDC10_YEAST Cell division control protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC10 PE=1 SV=1 1 299 7.0E-74
sp|Q4V8G5|SEP12_RAT Septin-12 OS=Rattus norvegicus GN=Sept12 PE=1 SV=2 6 299 8.0E-73
sp|P32457|CDC3_YEAST Cell division control protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC3 PE=1 SV=3 12 373 4.0E-72
sp|Q8IYM1|SEP12_HUMAN Septin-12 OS=Homo sapiens GN=SEPT12 PE=1 SV=1 6 299 1.0E-71
sp|A5D7Q3|SEP12_BOVIN Septin-12 OS=Bos taurus GN=SEPT12 PE=2 SV=1 5 295 2.0E-69
sp|P39827|CDC10_CANAL Cell division control protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC10 PE=2 SV=1 3 311 2.0E-68
sp|P48008|SPN3_SCHPO Septin homolog spn3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn3 PE=1 SV=3 26 338 2.0E-63
sp|P32458|CDC11_YEAST Cell division control protein 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC11 PE=1 SV=1 27 299 1.0E-56
sp|P48010|SPN5_SCHPO Septin homolog spn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn5 PE=1 SV=2 12 346 2.0E-56
sp|Q59VX8|SHS1_CANAL Septation protein 7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEP7 PE=1 SV=1 26 299 5.0E-45
sp|Q8SSI8|CDC3_ENCCU Cell division control protein 3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC3 PE=1 SV=1 12 350 4.0E-44
sp|O60165|SPN7_SCHPO Septin homolog spn7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn7 PE=1 SV=2 18 299 5.0E-43
sp|Q8STS8|CDC11_ENCCU Cell division control protein 11 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC11 PE=1 SV=2 24 300 4.0E-41
sp|G1UB61|CDC11_CANAL Septin CDC11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC11 PE=1 SV=1 21 382 1.0E-40
sp|Q8SQR3|CDC10_ENCCU Cell division control protein 10 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC10 PE=1 SV=2 12 346 1.0E-37
sp|Q07657|SHS1_YEAST Seventh homolog of septin 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHS1 PE=1 SV=1 5 301 2.0E-37
sp|Q04921|SPR28_YEAST Sporulation-regulated protein 28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPR28 PE=1 SV=1 27 303 2.0E-35
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1315
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6939 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5852
Ophiocordyceps camponoti-floridani Ophcf2|04828
Ophiocordyceps camponoti-rufipedis Ophun1|5852
Ophiocordyceps kimflemingae Ophio5|5166
Ophiocordyceps subramaniannii Hirsu2|10665

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6939
MAPAASESASPIGIANLPNQRHKIVAKRGASFTIMVAGESGLGKTTFINTLFSTTIKNYADHKKRHQKQVDKTVE
IEITKAELEEKFFKVRLTVIDTPGFGDYVNNRDSWMPIIEFLDDQHESYMLQEQQPRRQDKIDLRVHACLYFIRP
TGHSLKPLDIEVMKRLCSRVNLIPVIAKADTLSPADLAKFKSRIKSVIEAQNIKIYQPPVEEDDEAAAQHARSLM
AAVPFAVIGSEKDVKTSDGRIVKGRQYSWGVAEVENEDHCDFKKLRSILIRTHMLDLIHTTEELHYEAYRAQQME
TRKFGEARPRKLDNPKFKEEEEALRKRFTEQVKIEEQRFRQWEQKLIAERDRLNKDLEQTHAQIKQLEGELESMQ
GSAVRSHGRR*
Coding >OphauG2|6939
ATGGCTCCTGCCGCTTCTGAAAGCGCCTCGCCCATTGGCATTGCCAACCTCCCCAATCAGCGACACAAGATTGTT
GCCAAACGGGGAGCCAGCTTCACCATCATGGTTGCCGGCGAGTCGGGCCTGGGCAAGACCACCTTTATCAACACC
CTCTTCTCCACCACTATCAAAAACTATGCCGATCACAAGAAGCGCCATCAGAAGCAGGTGGACAAGACGGTTGAG
ATTGAAATCACAAAGGCCGAGCTCGAAGAAAAGTTCTTCAAGGTTCGCCTGACTGTCATTGACACGCCTGGCTTC
GGCGATTATGTCAACAACCGGGACTCGTGGATGCCCATTATTGAGTTTCTTGACGACCAGCACGAGTCGTACATG
CTTCAAGAGCAGCAACCTCGTCGCCAGGATAAGATTGACCTCCGCGTTCATGCCTGCTTGTACTTTATTCGCCCA
ACCGGCCACTCCCTCAAGCCTCTTGATATCGAGGTGATGAAGAGACTTTGCTCCCGTGTGAACCTGATTCCCGTC
ATTGCAAAGGCAGACACCCTCAGCCCTGCTGACCTGGCCAAATTCAAGTCAAGGATCAAATCCGTTATTGAAGCC
CAAAACATCAAAATCTACCAGCCCCCGGTTGAAGAGGACGACGAAGCTGCTGCCCAGCATGCCCGCAGCCTCATG
GCTGCCGTGCCGTTTGCTGTCATTGGCTCAGAAAAGGACGTCAAGACTAGCGACGGCCGCATCGTCAAGGGTCGT
CAGTACTCGTGGGGCGTTGCCGAAGTTGAGAATGAGGACCACTGTGATTTTAAGAAGCTGCGATCTATCCTCATC
CGAACCCATATGCTCGACCTGATTCACACTACCGAAGAGCTCCACTACGAGGCCTACCGTGCGCAGCAAATGGAG
ACACGCAAGTTTGGTGAAGCGCGTCCCCGGAAGCTCGACAACCCCAAGTTCAAGGAGGAGGAAGAAGCTCTGCGG
AAGCGCTTTACCGAGCAAGTCAAGATTGAGGAGCAACGATTCAGACAGTGGGAGCAAAAGCTCATTGCCGAGCGA
GACCGTCTCAACAAGGACCTGGAGCAGACGCACGCACAGATCAAGCAACTCGAGGGAGAGCTGGAGTCGATGCAA
GGCAGCGCTGTCCGCAGCCACGGCCGCCGCTGA
Transcript >OphauG2|6939
ATGGCTCCTGCCGCTTCTGAAAGCGCCTCGCCCATTGGCATTGCCAACCTCCCCAATCAGCGACACAAGATTGTT
GCCAAACGGGGAGCCAGCTTCACCATCATGGTTGCCGGCGAGTCGGGCCTGGGCAAGACCACCTTTATCAACACC
CTCTTCTCCACCACTATCAAAAACTATGCCGATCACAAGAAGCGCCATCAGAAGCAGGTGGACAAGACGGTTGAG
ATTGAAATCACAAAGGCCGAGCTCGAAGAAAAGTTCTTCAAGGTTCGCCTGACTGTCATTGACACGCCTGGCTTC
GGCGATTATGTCAACAACCGGGACTCGTGGATGCCCATTATTGAGTTTCTTGACGACCAGCACGAGTCGTACATG
CTTCAAGAGCAGCAACCTCGTCGCCAGGATAAGATTGACCTCCGCGTTCATGCCTGCTTGTACTTTATTCGCCCA
ACCGGCCACTCCCTCAAGCCTCTTGATATCGAGGTGATGAAGAGACTTTGCTCCCGTGTGAACCTGATTCCCGTC
ATTGCAAAGGCAGACACCCTCAGCCCTGCTGACCTGGCCAAATTCAAGTCAAGGATCAAATCCGTTATTGAAGCC
CAAAACATCAAAATCTACCAGCCCCCGGTTGAAGAGGACGACGAAGCTGCTGCCCAGCATGCCCGCAGCCTCATG
GCTGCCGTGCCGTTTGCTGTCATTGGCTCAGAAAAGGACGTCAAGACTAGCGACGGCCGCATCGTCAAGGGTCGT
CAGTACTCGTGGGGCGTTGCCGAAGTTGAGAATGAGGACCACTGTGATTTTAAGAAGCTGCGATCTATCCTCATC
CGAACCCATATGCTCGACCTGATTCACACTACCGAAGAGCTCCACTACGAGGCCTACCGTGCGCAGCAAATGGAG
ACACGCAAGTTTGGTGAAGCGCGTCCCCGGAAGCTCGACAACCCCAAGTTCAAGGAGGAGGAAGAAGCTCTGCGG
AAGCGCTTTACCGAGCAAGTCAAGATTGAGGAGCAACGATTCAGACAGTGGGAGCAAAAGCTCATTGCCGAGCGA
GACCGTCTCAACAAGGACCTGGAGCAGACGCACGCACAGATCAAGCAACTCGAGGGAGAGCTGGAGTCGATGCAA
GGCAGCGCTGTCCGCAGCCACGGCCGCCGCTGA
Gene >OphauG2|6939
ATGGCTCCTGCCGCTTCTGAAAGCGCCTCGCCCATTGGCATTGCCAACCTCCCCAATCAGCGACACAAGATTGTT
GCCAAACGGGGAGCCAGCTTCACCATCATGGTATGTCAATTCCATCCCTCTGCTGCTCCCACACGCCTCTTGACC
CTGCATCCAGGTTGCCGGCGAGTCGGGCCTGGGCAAGACCACCTTTATCAACACCCTCTTCTCCACCACTATCAA
AAACTATGCCGATCACAAGAAGCGCCATCAGAAGCAGGTGGACAAGACGGTTGAGATTGAAATCACAAAGGCCGA
GCTCGAAGAAAAGTTCTTCAAGGGTATATGCCATGTCCCGCCGCCCTGCTCTGCTGCCAGCTGACCCCGCTTCCC
TGTAGTTCGCCTGACTGTCATTGACACGCCTGGCTTCGGCGATTATGTCAACAACCGGGACTCGTGGATGCCCAT
TATTGAGTTTCTTGACGACCAGCACGAGTCGTACATGCTTCAAGAGCAGCAACCTCGTCGCCAGGATAAGATTGA
CCTCCGCGTTCATGCCTGCTTGTACTTTATTCGCCCAACCGGCCACTCCCTCAAGCCTCTTGATATCGAGGTGAT
GAAGAGACTTTGCTCCCGTGTGAACCTGATTCCCGTCATTGCAAAGGCAGACACCCTCAGCCCTGCTGACCTGGC
CAAATTCAAGTCAAGGGTATGTTCACTTCCTTGATGGCCTAGGCTTGCTCGTGCTGATGAAATTGCAGATCAAAT
CCGTTATTGAAGCCCAAAACATCAAAATCTACCAGCCCCCGGTTGAAGAGGACGACGAAGCTGCTGCCCAGCATG
CCCGCAGCCTCATGGCTGCCGTGCCGTTTGCTGTCATTGGCTCAGAAAAGGACGTCAAGACTAGCGACGGCCGCA
TCGTCAAGGGTCGTCAGTACTCGTGGGGCGTTGCCGAAGTTGAGAATGAGGACCACTGTGATTTTAAGAAGCTGC
GATCTATCCTCATCCGAACCCATATGCTCGACCTGATTCACACTACCGAAGAGCTCCACTACGAGGCCTACCGTG
CGCAGCAAATGGAGACACGCAAGTTTGGTGAAGCGCGTCCCCGGAAGCTCGACAACCCCAAGTTCAAGGAGGAGG
AAGAAGCTCTGCGGAAGCGCTTTACCGAGCAAGTCAAGATTGAGGAGCAACGATTCAGACAGTGGGAGCAAAAGC
TCATTGCCGAGCGAGACCGTCTCAACAAGGACCTGGAGCAGACGCACGCACAGATCAAGCAACTCGAGGGAGAGC
TGGAGTCGATGCAAGGCAGCGCTGTCCGCAGCCACGGCCGCCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail