Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6935
Gene name
LocationContig_759:8604..9136
Strand+
Gene length (bp)532
Transcript length (bp)420
Coding sequence length (bp)420
Protein length (aa) 140

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10294 Methyltransf_16 Lysine methyltransferase 2.0E-19 2 92

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53970|EFM6_YEAST Protein-lysine N-methyltransferase EFM6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFM6 PE=1 SV=1 1 120 5.0E-15

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6935
MVGLARHNIRINGLESRATALVVNWGEALPQAVIQQRPSIILAADCVYFEPAFPLLMQTLQDLLALNAEAVVYFC
FKKRRRADLHFVKVAKKAFLVEELFDHDRPVFARQALHLFSLRSKASKAKNAAPATDTRVAVAR*
Coding >OphauG2|6935
ATGGTTGGCCTGGCACGGCACAATATCCGCATCAACGGGCTAGAATCGAGAGCGACGGCGCTCGTTGTCAACTGG
GGCGAGGCACTACCGCAGGCCGTGATACAACAGCGGCCCAGCATCATCTTGGCTGCCGACTGTGTCTACTTTGAG
CCCGCCTTTCCTCTGCTCATGCAGACGCTCCAGGACCTATTGGCTCTCAACGCCGAGGCTGTAGTCTACTTTTGC
TTCAAGAAGCGCCGGCGGGCCGACTTGCATTTTGTCAAGGTTGCTAAAAAGGCGTTTCTGGTGGAGGAGCTCTTT
GACCACGACAGGCCCGTCTTTGCGCGCCAGGCGCTGCATCTCTTCAGCCTTCGATCCAAGGCATCCAAGGCAAAG
AATGCAGCACCTGCTACGGACACCAGAGTTGCCGTGGCAAGGTAG
Transcript >OphauG2|6935
ATGGTTGGCCTGGCACGGCACAATATCCGCATCAACGGGCTAGAATCGAGAGCGACGGCGCTCGTTGTCAACTGG
GGCGAGGCACTACCGCAGGCCGTGATACAACAGCGGCCCAGCATCATCTTGGCTGCCGACTGTGTCTACTTTGAG
CCCGCCTTTCCTCTGCTCATGCAGACGCTCCAGGACCTATTGGCTCTCAACGCCGAGGCTGTAGTCTACTTTTGC
TTCAAGAAGCGCCGGCGGGCCGACTTGCATTTTGTCAAGGTTGCTAAAAAGGCGTTTCTGGTGGAGGAGCTCTTT
GACCACGACAGGCCCGTCTTTGCGCGCCAGGCGCTGCATCTCTTCAGCCTTCGATCCAAGGCATCCAAGGCAAAG
AATGCAGCACCTGCTACGGACACCAGAGTTGCCGTGGCAAGGTAG
Gene >OphauG2|6935
ATGGTTGGCCTGGCACGGCACAATATCCGCATCAACGGGCTAGAATCGAGAGCGACGGCGCTCGTTGTCAACTGG
TGAGTACCGAGTCACTCGATTTTCGGGGCTGTTTGTATGAGAGAGACAAGACTACTTTTTGCAAAAATACAGAGT
ACCATGATACGTGTCTGACGGCCTCTGGGCAACTAGGGGCGAGGCACTACCGCAGGCCGTGATACAACAGCGGCC
CAGCATCATCTTGGCTGCCGACTGTGTCTACTTTGAGCCCGCCTTTCCTCTGCTCATGCAGACGCTCCAGGACCT
ATTGGCTCTCAACGCCGAGGCTGTAGTCTACTTTTGCTTCAAGAAGCGCCGGCGGGCCGACTTGCATTTTGTCAA
GGTTGCTAAAAAGGCGTTTCTGGTGGAGGAGCTCTTTGACCACGACAGGCCCGTCTTTGCGCGCCAGGCGCTGCA
TCTCTTCAGCCTTCGATCCAAGGCATCCAAGGCAAAGAATGCAGCACCTGCTACGGACACCAGAGTTGCCGTGGC
AAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail