Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6932
Gene name
LocationContig_758:8132..9184
Strand+
Gene length (bp)1052
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14521 Aspzincin_M35 Lysine-specific metallo-endopeptidase 1.2E-08 111 203
PF02102 Peptidase_M35 Deuterolysin metalloprotease (M35) family 4.6E-10 52 174

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B8NWE1|NPIIB_ASPFN Neutral protease 2 homolog AFLA_119780 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_119780 PE=3 SV=1 52 309 5.0E-09
sp|C4JH04|NPIIC_UNCRE Neutral protease 2 homolog UREG_01255 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_01255 PE=3 SV=1 121 306 1.0E-08
sp|Q0V1D7|NPIIB_PHANO Neutral protease 2 homolog SNOG_02177 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_02177 PE=3 SV=1 6 309 2.0E-08
sp|Q4WA45|NPIIC_ASPFU Neutral protease 2 homolog AFUB_070680 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G02700 PE=3 SV=3 70 321 9.0E-08
sp|Q5B7T7|NPIIB_EMENI Neutral protease 2 homolog AN3393 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN3393 PE=3 SV=1 52 309 4.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B8NWE1|NPIIB_ASPFN Neutral protease 2 homolog AFLA_119780 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_119780 PE=3 SV=1 52 309 5.0E-09
sp|C4JH04|NPIIC_UNCRE Neutral protease 2 homolog UREG_01255 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_01255 PE=3 SV=1 121 306 1.0E-08
sp|Q0V1D7|NPIIB_PHANO Neutral protease 2 homolog SNOG_02177 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_02177 PE=3 SV=1 6 309 2.0E-08
sp|Q4WA45|NPIIC_ASPFU Neutral protease 2 homolog AFUB_070680 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G02700 PE=3 SV=3 70 321 9.0E-08
sp|Q5B7T7|NPIIB_EMENI Neutral protease 2 homolog AN3393 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN3393 PE=3 SV=1 52 309 4.0E-07
sp|C4JK49|NPIIB_UNCRE Neutral protease 2 homolog UREG_02006 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_02006 PE=3 SV=1 95 174 5.0E-07
sp|B0YEV0|NPIIA_ASPFC Neutral protease 2 homolog AFUB_100460 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_100460 PE=3 SV=2 70 311 6.0E-07
sp|A1CIU4|NPIIA_ASPCL Neutral protease 2 homolog ACLA_052720 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_052720 PE=3 SV=1 124 309 1.0E-06
sp|P47189|PLNC_PENCI Penicillolysin OS=Penicillium citrinum GN=plnC PE=1 SV=1 52 309 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004222 metalloendopeptidase activity Yes
GO:0006508 proteolysis Yes
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0008233 peptidase activity No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0003824 catalytic activity No
GO:0004175 endopeptidase activity No
GO:0044238 primary metabolic process No
GO:0016787 hydrolase activity No
GO:0008237 metallopeptidase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6932
MKSAILLAVASTVLAQLGSKVPEDLTVVADRGGASRPLRRQLSPVLGSKLLSDDLTVVSDSGKSGSHDTLGRRAE
QANDCGNKATTANADPATFVDKSLDDCSRMARAAAAAADDQSSPLIKAFFKRDTPDVRSKVSGLFRAIEQECGKP
HAGESVVTCADRLGDCGTGASAVTRWGGGQGTSVLLCDEFFTHGFVEKQSTTQKEDNPNQEAHGGSRRRSRLARR
QQPTGDLQPTERPMCARLDPSGVMLHEMTHAIGHTTDDGEAPKSYLDGGSAKYGLQAVGSMPAELNINHADTYAL
FAHAASINCTMQDLETGGPPTAY*
Coding >OphauG2|6932
ATGAAGTCGGCCATCTTACTTGCCGTGGCCTCGACTGTGCTGGCCCAGCTTGGTTCCAAGGTGCCCGAGGACCTG
ACTGTTGTTGCAGACCGCGGCGGCGCCTCGCGCCCCCTGAGACGCCAGCTCTCGCCCGTCTTGGGCTCCAAGCTC
CTCAGCGACGACCTGACTGTCGTGTCCGACTCTGGCAAGTCTGGCAGCCATGACACCTTGGGGCGACGCGCCGAG
CAGGCCAACGACTGTGGCAACAAGGCCACGACCGCCAACGCGGACCCGGCCACGTTTGTCGACAAGAGTCTGGAT
GACTGCTCCCGCATGGCTCGCGCCGCAGCAGCAGCGGCCGACGACCAAAGCTCGCCCCTTATCAAGGCCTTCTTC
AAGCGCGACACCCCCGACGTCAGGTCCAAGGTCAGCGGCCTATTCCGCGCCATCGAACAGGAGTGCGGTAAGCCC
CACGCTGGCGAGAGCGTCGTCACGTGTGCCGACCGCCTGGGCGACTGTGGAACGGGAGCAAGTGCCGTGACGCGC
TGGGGCGGCGGCCAGGGCACCTCGGTACTGCTCTGCGATGAATTCTTCACCCACGGCTTTGTTGAGAAGCAGTCA
ACCACCCAAAAGGAAGACAATCCCAACCAGGAGGCCCATGGGGGCTCCAGACGCCGCAGCCGCTTGGCCCGCCGT
CAGCAGCCCACTGGCGACCTTCAGCCCACTGAACGGCCCATGTGTGCCAGACTTGACCCCAGCGGCGTCATGCTT
CACGAGATGACGCATGCCATTGGCCATACCACCGACGATGGTGAGGCCCCCAAGTCCTACTTGGACGGCGGCTCG
GCCAAGTACGGTCTCCAGGCTGTGGGCAGCATGCCGGCTGAACTCAACATCAACCACGCCGACACATATGCCCTC
TTTGCCCATGCTGCCTCCATCAACTGTACCATGCAAGATTTGGAGACTGGCGGCCCCCCTACGGCCTATTGA
Transcript >OphauG2|6932
ATGAAGTCGGCCATCTTACTTGCCGTGGCCTCGACTGTGCTGGCCCAGCTTGGTTCCAAGGTGCCCGAGGACCTG
ACTGTTGTTGCAGACCGCGGCGGCGCCTCGCGCCCCCTGAGACGCCAGCTCTCGCCCGTCTTGGGCTCCAAGCTC
CTCAGCGACGACCTGACTGTCGTGTCCGACTCTGGCAAGTCTGGCAGCCATGACACCTTGGGGCGACGCGCCGAG
CAGGCCAACGACTGTGGCAACAAGGCCACGACCGCCAACGCGGACCCGGCCACGTTTGTCGACAAGAGTCTGGAT
GACTGCTCCCGCATGGCTCGCGCCGCAGCAGCAGCGGCCGACGACCAAAGCTCGCCCCTTATCAAGGCCTTCTTC
AAGCGCGACACCCCCGACGTCAGGTCCAAGGTCAGCGGCCTATTCCGCGCCATCGAACAGGAGTGCGGTAAGCCC
CACGCTGGCGAGAGCGTCGTCACGTGTGCCGACCGCCTGGGCGACTGTGGAACGGGAGCAAGTGCCGTGACGCGC
TGGGGCGGCGGCCAGGGCACCTCGGTACTGCTCTGCGATGAATTCTTCACCCACGGCTTTGTTGAGAAGCAGTCA
ACCACCCAAAAGGAAGACAATCCCAACCAGGAGGCCCATGGGGGCTCCAGACGCCGCAGCCGCTTGGCCCGCCGT
CAGCAGCCCACTGGCGACCTTCAGCCCACTGAACGGCCCATGTGTGCCAGACTTGACCCCAGCGGCGTCATGCTT
CACGAGATGACGCATGCCATTGGCCATACCACCGACGATGGTGAGGCCCCCAAGTCCTACTTGGACGGCGGCTCG
GCCAAGTACGGTCTCCAGGCTGTGGGCAGCATGCCGGCTGAACTCAACATCAACCACGCCGACACATATGCCCTC
TTTGCCCATGCTGCCTCCATCAACTGTACCATGCAAGATTTGGAGACTGGCGGCCCCCCTACGGCCTATTGA
Gene >OphauG2|6932
ATGAAGTCGGCCATCTTACTTGCCGTGGCCTCGACTGTGCTGGCCCAGCTTGGTTCCAAGGTGCCCGAGGACCTG
ACTGTTGTTGCAGACCGCGGCGGCGCCTCGCGCCCCCTGAGACGCCAGCTCTCGCCCGTCTTGGGCTCCAAGCTC
CTCAGCGACGACCTGACTGTCGTGTCCGACTCTGGCAAGTCTGGCAGCCATGACACCTTGGGGCGACGCGCCGAG
CAGGCCAACGACTGTGGCAACAAGGCCACGACCGCCAACGCGGACCCGGCCACGTTTGTCGACAAGAGTCTGGAT
GACTGCTCCCGCATGGCTCGCGCCGCAGCAGCAGCGGCCGACGACCAAAGCTCGCCCCTTATCAAGGCCTTCTTC
AAGCGCGACACCCCCGACGTCAGGTCCAAGGTCAGCGGCCTATTCCGCGCCATCGAACAGGAGTGCGGTAAGCCC
CACGCTGGCGAGAGCGTCGTCACGTGTGCCGACCGCCTGGGCGACTGTGGAACGGGAGCAAGTGCCGTGACGCGC
TGGGGCGGCGGCCAGGGCACCTCGGTACTGCTCTGCGATGAATTCTTCACCCACGGCTTTGTTGAGAAGCAGTCA
ACCACCCAAAAGGAAGACAATCCCAACCAGGAGGCCCATGGGGGCTCCAGACGCCGCAGCCGCTTGGCCCGCCGT
CAGCAGCCCACTGGCGACCTTCAGCCCACTGAACGGCCCATGTGTGCCAGACTTGACCCCAGCGGCGTCATGCTT
CACGAGATGACGCATGCCATTGGCCATACCACCGACGATGGTGAGGCCCCCAAGTCCTACTTGGACGGCGGCTCG
GCCAAGTACGGTCTCCAGGCTGTGGGCAGCATGCCGGCTGAACTCAACATCAACCACGCCGACACATATGCCCTC
TTTGCCCATGCTGCCTCCATCAACTGTACCATGCAAGATTTGGAGACTGGCGGCCCCCCTACGGGTGAAGCCAAC
CCTGCCGGCCCAACTGGCGGCAACAACTCTACCGGCAATGACGACAAGAAGAAGGGCCCTACCACACAGCCTATT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail