Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6922
Gene name
LocationContig_756:2186..3003
Strand+
Gene length (bp)817
Transcript length (bp)744
Coding sequence length (bp)744
Protein length (aa) 248

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 5.8E-05 120 152

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2447
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6922 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|780
Ophiocordyceps camponoti-floridani Ophcf2|04504
Ophiocordyceps camponoti-rufipedis Ophun1|5646
Ophiocordyceps kimflemingae Ophio5|5811
Ophiocordyceps subramaniannii Hirsu2|35

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6922
MDSCCTCATIQSPAVTSPHSQHRIVECCDRIICAKCLQSNPRFSRYCPFCQISSHPSPLPQRLRDPPPYTPLPRT
RLANSQPCPPPPYTPSAAPGPSTQASHAKSEKPNDTLHFLDHNHDSISSLSLRYGVPQSALRSANNITSDHLLLG
RKTILIPAQYYMAGISLSPLPINGEHEELRKAKIRRFMTSCKESDYDVALLYLEQSDYDVAAATASYLDDEAWEK
SHPKQPRAKPRSFTATVLRSRR*
Coding >OphauG2|6922
ATGGACTCGTGTTGTACTTGTGCCACCATTCAATCTCCAGCAGTTACAAGTCCCCATTCTCAGCATCGTATAGTC
GAGTGCTGCGACCGCATTATCTGCGCCAAATGCCTCCAAAGTAATCCTCGTTTTTCGCGCTACTGTCCCTTTTGC
CAGATTTCCAGCCATCCCTCTCCTCTCCCCCAGCGACTCCGCGATCCGCCTCCCTACACCCCTCTCCCTCGTACT
CGACTTGCCAATAGCCAGCCTTGCCCTCCGCCGCCCTACACTCCCAGCGCCGCACCAGGCCCAAGCACTCAAGCG
TCGCACGCCAAATCCGAGAAACCAAACGACACGCTTCACTTTCTCGACCACAACCACGACTCCATCTCCTCCCTC
TCCCTTCGCTATGGCGTCCCGCAATCCGCCCTGCGTAGCGCCAACAACATCACGAGCGACCACTTGTTACTTGGC
AGGAAAACAATCCTCATTCCTGCACAGTATTACATGGCTGGCATTAGCCTCTCTCCACTGCCAATCAACGGCGAG
CACGAGGAGCTGCGCAAGGCCAAAATTCGCCGCTTCATGACCTCTTGCAAAGAGTCCGACTATGATGTCGCCTTG
CTCTATCTCGAACAGTCTGATTACGATGTAGCAGCAGCCACAGCATCATACCTGGATGACGAGGCTTGGGAAAAA
AGCCATCCAAAGCAGCCACGTGCGAAGCCAAGGTCATTCACAGCCACTGTGCTGAGGAGTCGTCGCTGA
Transcript >OphauG2|6922
ATGGACTCGTGTTGTACTTGTGCCACCATTCAATCTCCAGCAGTTACAAGTCCCCATTCTCAGCATCGTATAGTC
GAGTGCTGCGACCGCATTATCTGCGCCAAATGCCTCCAAAGTAATCCTCGTTTTTCGCGCTACTGTCCCTTTTGC
CAGATTTCCAGCCATCCCTCTCCTCTCCCCCAGCGACTCCGCGATCCGCCTCCCTACACCCCTCTCCCTCGTACT
CGACTTGCCAATAGCCAGCCTTGCCCTCCGCCGCCCTACACTCCCAGCGCCGCACCAGGCCCAAGCACTCAAGCG
TCGCACGCCAAATCCGAGAAACCAAACGACACGCTTCACTTTCTCGACCACAACCACGACTCCATCTCCTCCCTC
TCCCTTCGCTATGGCGTCCCGCAATCCGCCCTGCGTAGCGCCAACAACATCACGAGCGACCACTTGTTACTTGGC
AGGAAAACAATCCTCATTCCTGCACAGTATTACATGGCTGGCATTAGCCTCTCTCCACTGCCAATCAACGGCGAG
CACGAGGAGCTGCGCAAGGCCAAAATTCGCCGCTTCATGACCTCTTGCAAAGAGTCCGACTATGATGTCGCCTTG
CTCTATCTCGAACAGTCTGATTACGATGTAGCAGCAGCCACAGCATCATACCTGGATGACGAGGCTTGGGAAAAA
AGCCATCCAAAGCAGCCACGTGCGAAGCCAAGGTCATTCACAGCCACTGTGCTGAGGAGTCGTCGCTGA
Gene >OphauG2|6922
ATGGACTCGTGTTGTACTTGTGCCACCATTCAATCTCCAGCAGTTACAAGTCCCCATTCTCAGCATCGTATAGTC
GAGTGCTGCGACCGCATTATCTGCGCCAAATGCCTCCAAGTATGCCCCCCCCCTCTTGGCATTCTACAAGACCCT
CCAAACTTGCCGTCGTGCCTTCTAACAAAGACGCTAGAGTAATCCTCGTTTTTCGCGCTACTGTCCCTTTTGCCA
GATTTCCAGCCATCCCTCTCCTCTCCCCCAGCGACTCCGCGATCCGCCTCCCTACACCCCTCTCCCTCGTACTCG
ACTTGCCAATAGCCAGCCTTGCCCTCCGCCGCCCTACACTCCCAGCGCCGCACCAGGCCCAAGCACTCAAGCGTC
GCACGCCAAATCCGAGAAACCAAACGACACGCTTCACTTTCTCGACCACAACCACGACTCCATCTCCTCCCTCTC
CCTTCGCTATGGCGTCCCGCAATCCGCCCTGCGTAGCGCCAACAACATCACGAGCGACCACTTGTTACTTGGCAG
GAAAACAATCCTCATTCCTGCACAGTATTACATGGCTGGCATTAGCCTCTCTCCACTGCCAATCAACGGCGAGCA
CGAGGAGCTGCGCAAGGCCAAAATTCGCCGCTTCATGACCTCTTGCAAAGAGTCCGACTATGATGTCGCCTTGCT
CTATCTCGAACAGTCTGATTACGATGTAGCAGCAGCCACAGCATCATACCTGGATGACGAGGCTTGGGAAAAAAG
CCATCCAAAGCAGCCACGTGCGAAGCCAAGGTCATTCACAGCCACTGTGCTGAGGAGTCGTCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail