Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6919
Gene name
LocationContig_755:7037..8069
Strand-
Gene length (bp)1032
Transcript length (bp)861
Coding sequence length (bp)861
Protein length (aa) 287

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases 4.8E-22 1 236

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZI0|DPH5_GIBZE Diphthine methyl ester synthase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DPH5 PE=3 SV=1 1 286 4.0E-169
sp|Q7S949|DPH5_NEUCR Diphthine methyl ester synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dph-5 PE=3 SV=1 1 286 4.0E-162
sp|Q6MY91|DPH5_ASPFU Diphthine methyl ester synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dph5 PE=3 SV=1 1 284 5.0E-143
sp|Q5BFG0|DPH5_EMENI Diphthine methyl ester synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dph5 PE=3 SV=2 1 280 3.0E-141
sp|O74898|DPH5_SCHPO Diphthine methyl ester synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph5 PE=3 SV=1 1 281 2.0E-118
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZI0|DPH5_GIBZE Diphthine methyl ester synthase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DPH5 PE=3 SV=1 1 286 4.0E-169
sp|Q7S949|DPH5_NEUCR Diphthine methyl ester synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dph-5 PE=3 SV=1 1 286 4.0E-162
sp|Q6MY91|DPH5_ASPFU Diphthine methyl ester synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dph5 PE=3 SV=1 1 284 5.0E-143
sp|Q5BFG0|DPH5_EMENI Diphthine methyl ester synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dph5 PE=3 SV=2 1 280 3.0E-141
sp|O74898|DPH5_SCHPO Diphthine methyl ester synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph5 PE=3 SV=1 1 281 2.0E-118
sp|Q6C1E0|DPH5_YARLI Diphthine methyl ester synthase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPH5 PE=3 SV=1 1 282 4.0E-118
sp|Q59NX9|DPH5_CANAL Diphthine methyl ester synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DPH5 PE=3 SV=1 1 282 1.0E-116
sp|Q6BN80|DPH5_DEBHA Diphthine methyl ester synthase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DPH5 PE=3 SV=1 1 282 1.0E-114
sp|P32469|DPH5_YEAST Diphthine methyl ester synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPH5 PE=1 SV=1 1 275 9.0E-112
sp|Q6FXK9|DPH5_CANGA Diphthine methyl ester synthase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DPH5 PE=3 SV=1 1 285 2.0E-111
sp|Q6CIZ1|DPH5_KLULA Diphthine methyl ester synthase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DPH5 PE=3 SV=1 1 275 6.0E-111
sp|Q754E7|DPH5_ASHGO Diphthine methyl ester synthase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DPH5 PE=3 SV=1 1 275 2.0E-109
sp|Q9CWQ0|DPH5_MOUSE Diphthine methyl ester synthase OS=Mus musculus GN=Dph5 PE=1 SV=2 1 274 5.0E-109
sp|Q9H2P9|DPH5_HUMAN Diphthine methyl ester synthase OS=Homo sapiens GN=DPH5 PE=1 SV=2 1 273 6.0E-109
sp|Q5E982|DPH5_BOVIN Diphthine methyl ester synthase OS=Bos taurus GN=DPH5 PE=2 SV=1 1 277 4.0E-107
sp|Q75JG8|DPH5_DICDI Diphthine methyl ester synthase OS=Dictyostelium discoideum GN=dph5 PE=3 SV=1 1 273 5.0E-103
sp|O81769|DPH5_ARATH Probable diphthine methyl ester synthase OS=Arabidopsis thaliana GN=At4g31790 PE=2 SV=1 1 255 7.0E-98
sp|Q58670|DPHB_METJA Diphthine synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=dphB PE=3 SV=1 1 263 1.0E-55
sp|A4FYP1|DPHB_METM5 Diphthine synthase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=dphB PE=3 SV=1 1 263 1.0E-54
sp|A6VJP1|DPHB_METM7 Diphthine synthase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=dphB PE=3 SV=1 1 263 3.0E-53
sp|A9A6D8|DPHB_METM6 Diphthine synthase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=dphB PE=3 SV=1 1 263 5.0E-53
sp|C5A3K4|DPHB_THEGJ Diphthine synthase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=dphB PE=3 SV=1 2 269 2.0E-52
sp|A6UU49|DPHB_META3 Diphthine synthase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=dphB PE=3 SV=1 1 274 2.0E-52
sp|Q6LZN6|DPHB_METMP Diphthine synthase OS=Methanococcus maripaludis (strain S2 / LL) GN=dphB PE=3 SV=1 1 263 4.0E-52
sp|A6US81|DPHB_METVS Diphthine synthase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=dphB PE=3 SV=1 1 263 8.0E-51
sp|Q5JFE7|DPHB_THEKO Diphthine synthase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=dphB PE=3 SV=1 1 269 2.0E-50
sp|Q8U377|DPHB_PYRFU Diphthine synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=dphB PE=3 SV=1 2 269 8.0E-50
sp|B6YXP9|DPHB_THEON Diphthine synthase OS=Thermococcus onnurineus (strain NA1) GN=dphB PE=3 SV=1 2 269 4.0E-48
sp|Q9UZ31|DPHB_PYRAB Diphthine synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=dphB PE=3 SV=1 2 269 7.0E-48
sp|O58456|DPHB_PYRHO Diphthine synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=dphB PE=1 SV=1 1 269 2.0E-46
sp|A7IA21|DPHB_METB6 Diphthine synthase OS=Methanoregula boonei (strain 6A8) GN=dphB PE=3 SV=1 1 269 3.0E-46
sp|A2SQF6|DPHB_METLZ Diphthine synthase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=dphB PE=3 SV=1 1 269 3.0E-42
sp|Q8PUH9|DPHB_METMA Diphthine synthase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dphB PE=3 SV=1 1 261 2.0E-41
sp|Q0W085|DPHB_METAR Diphthine synthase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=dphB PE=3 SV=1 1 269 4.0E-41
sp|Q2FQ45|DPHB_METHJ Diphthine synthase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=dphB PE=3 SV=1 1 269 2.0E-40
sp|O29866|DPHB_ARCFU Diphthine synthase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=dphB PE=1 SV=1 1 269 4.0E-40
sp|A0B879|DPHB_METTP Diphthine synthase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=dphB PE=3 SV=1 1 269 3.0E-39
sp|Q2NFJ8|DPHB_METST Diphthine synthase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=dphB PE=3 SV=1 1 261 7.0E-39
sp|Q8TR14|DPHB_METAC Diphthine synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dphB PE=3 SV=1 1 261 1.0E-38
sp|A3CWF9|DPHB_METMJ Diphthine synthase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=dphB PE=3 SV=1 1 269 1.0E-38
sp|B8GIF8|DPHB_METPE Diphthine synthase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=dphB PE=3 SV=1 1 269 2.0E-37
sp|Q467Z4|DPHB_METBF Diphthine synthase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=dphB PE=3 SV=1 1 261 6.0E-37
sp|Q12XB4|DPHB_METBU Diphthine synthase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=dphB PE=3 SV=1 1 261 2.0E-36
sp|O27902|DPHB_METTH Diphthine synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=dphB PE=3 SV=1 1 269 2.0E-36
sp|Q9HQK6|DPHB_HALSA Diphthine synthase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=dphB PE=3 SV=2 1 269 3.0E-33
sp|B0R4W9|DPHB_HALS3 Diphthine synthase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=dphB PE=3 SV=1 1 269 3.0E-33
sp|Q5V2B7|DPHB_HALMA Diphthine synthase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=dphB PE=3 SV=1 1 263 6.0E-33
sp|Q18JS3|DPHB_HALWD Diphthine synthase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=dphB PE=3 SV=1 1 254 5.0E-29
sp|B9LV13|DPHB_HALLT Diphthine synthase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=dphB PE=3 SV=1 1 259 1.0E-28
sp|Q8TXC7|DPHB_METKA Diphthine synthase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=dphB PE=3 SV=1 2 267 1.0E-25
sp|Q979Z8|DPHB_THEVO Diphthine synthase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=dphB PE=3 SV=1 1 166 2.0E-24
sp|Q9HJT0|DPHB_THEAC Diphthine synthase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dphB PE=3 SV=1 1 169 1.0E-23
sp|Q3IS55|DPHB_NATPD Diphthine synthase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=dphB PE=3 SV=1 1 263 6.0E-23
sp|A3DLV7|DPHB_STAMF Diphthine synthase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=dphB PE=3 SV=1 1 263 4.0E-22
sp|Q971V1|DPHB_SULTO Diphthine synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=dphB PE=3 SV=1 2 261 2.0E-21
sp|C3NDY5|DPHB_SULIY Diphthine synthase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=dphB PE=3 SV=1 1 263 4.0E-21
sp|C3NHR8|DPHB_SULIN Diphthine synthase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=dphB PE=3 SV=1 1 263 4.0E-21
sp|C3MYP9|DPHB_SULIM Diphthine synthase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=dphB PE=3 SV=1 1 263 4.0E-21
sp|C3MPQ5|DPHB_SULIL Diphthine synthase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=dphB PE=3 SV=1 1 263 4.0E-21
sp|C4KGZ7|DPHB_SULIK Diphthine synthase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=dphB PE=3 SV=1 1 263 4.0E-21
sp|C3N5D1|DPHB_SULIA Diphthine synthase OS=Sulfolobus islandicus (strain M.16.27) GN=dphB PE=3 SV=1 1 263 4.0E-21
sp|A4YHI8|DPHB_METS5 Diphthine synthase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=dphB PE=3 SV=1 2 261 7.0E-21
sp|Q97TX8|DPHB_SULSO Diphthine synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=dphB PE=3 SV=1 1 263 8.0E-20
sp|Q9YDI2|DPHB_AERPE Diphthine synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=dphB PE=1 SV=1 2 165 1.0E-17
sp|A1RU15|DPHB_PYRIL Diphthine synthase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=dphB PE=3 SV=1 1 222 2.0E-13
sp|B1YAU2|DPHB_PYRNV Diphthine synthase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=dphB PE=3 SV=1 1 209 3.0E-13
sp|Q8ZXR9|DPHB_PYRAE Diphthine synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=dphB PE=3 SV=1 1 202 4.0E-10
sp|A3MU14|DPHB_PYRCJ Diphthine synthase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=dphB PE=3 SV=1 1 216 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1091
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6919 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3918
Ophiocordyceps camponoti-floridani Ophcf2|03928
Ophiocordyceps camponoti-rufipedis Ophun1|5064
Ophiocordyceps kimflemingae Ophio5|5264
Ophiocordyceps subramaniannii Hirsu2|10092

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6919
MLHLVGLGLSDETDITVKGLDIVKRAERVYLDAYTSILLVDQSVLEQYYGRPVILADREMVESNSDEILRGAQHK
DIVFLVVGDPFGATTHSDLALRAKQQSIEVRSVPNASILSAIGACGLQLYNFGQTVSMVFFTDTWKPSSFYHRIK
ENVSIGLHTLVLADIQVKEPNLENLARGRKIYEPPRYMTVGQCASQMLQVEQERKEAVYTAKSLAIGAARVGSKT
EKFVAGTLQQLCSLDSELGPPLHSLVLLGRRIHVLEHDFARQFAIDQSEWDAIWKADYAKQ*
Coding >OphauG2|6919
ATGCTCCATCTTGTCGGTCTCGGCCTGTCAGACGAGACAGACATTACCGTCAAGGGCCTTGACATTGTCAAGAGA
GCCGAGCGCGTCTACCTCGATGCCTATACCAGTATCCTGCTCGTCGACCAGTCTGTCCTTGAGCAATACTATGGC
CGGCCTGTCATTCTTGCTGACCGCGAAATGGTCGAGTCGAATAGCGACGAAATCTTGCGTGGTGCCCAGCACAAG
GACATTGTCTTTCTCGTTGTCGGGGATCCTTTTGGCGCAACAACACACAGCGATCTCGCCTTGCGCGCCAAGCAG
CAGTCCATAGAGGTCCGCTCTGTCCCAAATGCCTCCATCCTGTCAGCAATTGGCGCCTGCGGTCTGCAGTTGTAC
AATTTTGGACAGACCGTCTCCATGGTCTTCTTCACCGATACGTGGAAGCCATCGTCCTTTTACCATCGCATCAAG
GAAAATGTATCCATAGGCCTTCATACTCTGGTGCTTGCCGACATCCAGGTCAAGGAGCCCAATCTGGAAAATCTC
GCCCGAGGAAGAAAGATTTATGAGCCGCCACGATACATGACTGTCGGCCAATGCGCCAGTCAGATGCTCCAGGTC
GAGCAGGAGAGAAAGGAAGCCGTCTACACTGCCAAGAGCCTAGCCATTGGTGCTGCCCGTGTGGGAAGCAAGACG
GAGAAATTCGTCGCAGGAACGCTGCAACAGCTCTGCTCACTTGATTCCGAGCTTGGTCCTCCGCTTCACAGTCTG
GTGCTGCTTGGAAGGCGGATACATGTCCTGGAACACGACTTTGCACGCCAATTTGCCATTGACCAGAGTGAATGG
GATGCAATTTGGAAGGCAGACTATGCCAAACAATGA
Transcript >OphauG2|6919
ATGCTCCATCTTGTCGGTCTCGGCCTGTCAGACGAGACAGACATTACCGTCAAGGGCCTTGACATTGTCAAGAGA
GCCGAGCGCGTCTACCTCGATGCCTATACCAGTATCCTGCTCGTCGACCAGTCTGTCCTTGAGCAATACTATGGC
CGGCCTGTCATTCTTGCTGACCGCGAAATGGTCGAGTCGAATAGCGACGAAATCTTGCGTGGTGCCCAGCACAAG
GACATTGTCTTTCTCGTTGTCGGGGATCCTTTTGGCGCAACAACACACAGCGATCTCGCCTTGCGCGCCAAGCAG
CAGTCCATAGAGGTCCGCTCTGTCCCAAATGCCTCCATCCTGTCAGCAATTGGCGCCTGCGGTCTGCAGTTGTAC
AATTTTGGACAGACCGTCTCCATGGTCTTCTTCACCGATACGTGGAAGCCATCGTCCTTTTACCATCGCATCAAG
GAAAATGTATCCATAGGCCTTCATACTCTGGTGCTTGCCGACATCCAGGTCAAGGAGCCCAATCTGGAAAATCTC
GCCCGAGGAAGAAAGATTTATGAGCCGCCACGATACATGACTGTCGGCCAATGCGCCAGTCAGATGCTCCAGGTC
GAGCAGGAGAGAAAGGAAGCCGTCTACACTGCCAAGAGCCTAGCCATTGGTGCTGCCCGTGTGGGAAGCAAGACG
GAGAAATTCGTCGCAGGAACGCTGCAACAGCTCTGCTCACTTGATTCCGAGCTTGGTCCTCCGCTTCACAGTCTG
GTGCTGCTTGGAAGGCGGATACATGTCCTGGAACACGACTTTGCACGCCAATTTGCCATTGACCAGAGTGAATGG
GATGCAATTTGGAAGGCAGACTATGCCAAACAATGA
Gene >OphauG2|6919
ATGCTCCATCTTGTCGGTCTCGGCCTGTCAGACGAGACAGACATTACCGTCAAGGGCCTTGACATTGTCAAGAGA
GCCGAGCGCGTCTACCTCGATGCCTATACCAGTATCCTGCTCGTCGACCAGTCTGTCCTTGTACCACGACCCAAC
TCCCCCGACGGGCCTTGACGCGAAGCCAAGCATCACTGATCAAAGCGCACTAGGAGCAATACTATGGCCGGCCTG
TCATTCTTGCTGACCGCGAAATGGTCGAGTCGAATAGCGACGAAATCTTGCGTGGTGCCCAGCACAAGGACATTG
TCTTTCTCGTTGTCGGGGATCCTTTTGGGTATTTCTGGCCTCTTTTCCTAAACTCTTTTTTTTTTCACTTTTTCC
TTTTATTCCACTTCTTTTCTTGGCATGCCGACAAGAGCTGGAGCTTACTCTTGCAGCGCAACAACACACAGCGAT
CTCGCCTTGCGCGCCAAGCAGCAGTCCATAGAGGTCCGCTCTGTCCCAAATGCCTCCATCCTGTCAGCAATTGGC
GCCTGCGGTCTGCAGTTGTACAATTTTGGACAGACCGTCTCCATGGTCTTCTTCACCGATACGTGGAAGCCATCG
TCCTTTTACCATCGCATCAAGGAAAATGTATCCATAGGCCTTCATACTCTGGTGCTTGCCGACATCCAGGTCAAG
GAGCCCAATCTGGAAAATCTCGCCCGAGGAAGAAAGATTTATGAGCCGCCACGATACATGACTGTCGGCCAATGC
GCCAGTCAGATGCTCCAGGTCGAGCAGGAGAGAAAGGAAGCCGTCTACACTGCCAAGAGCCTAGCCATTGGTGCT
GCCCGTGTGGGAAGCAAGACGGAGAAATTCGTCGCAGGAACGCTGCAACAGCTCTGCTCACTTGATTCCGAGCTT
GGTCCTCCGCTTCACAGTCTGGTGCTGCTTGGAAGGCGGATACATGTCCTGGAACACGACTTTGCACGCCAATTT
GCCATTGACCAGAGTGAATGGGATGCAATTTGGAAGGCAGACTATGCCAAACAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail