Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6918
Gene name
LocationContig_755:6193..6889
Strand+
Gene length (bp)696
Transcript length (bp)618
Coding sequence length (bp)618
Protein length (aa) 206

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16242 Pyrid_ox_like Pyridoxamine 5'-phosphate oxidase like 5.8E-21 29 182
PF01243 Putative_PNPOx Pyridoxamine 5'-phosphate oxidase 7.8E-08 34 117

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q01358|BLI3_NEUCR Protein bli-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-3 PE=2 SV=1 3 202 1.0E-92

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1090
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6918 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3917
Ophiocordyceps camponoti-floridani Ophcf2|03927
Ophiocordyceps camponoti-rufipedis Ophun1|5063
Ophiocordyceps kimflemingae Ophio5|5263
Ophiocordyceps subramaniannii Hirsu2|10091

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6918
MSFSNTSVGDKPADPYKKANLEEIDTKTKVQDLTSFVTGCKFGMMTTRESSSSHLVSRAMALAATETGGIDLLFH
TNTESGKTDDLASDSNVNIAFINSSGEWASISGEATIVTDRELVKKHYSSALKAWLGDLGDGKHDGSANDPRIGV
IRVKMFTATYSLCARNLIGRASEVVEGAITGKPAQPNRLRQISASEVSEWRTLNK*
Coding >OphauG2|6918
ATGTCCTTCTCAAATACTTCAGTCGGCGACAAGCCTGCCGATCCTTACAAAAAGGCCAACCTGGAGGAAATCGAC
ACCAAGACCAAGGTTCAAGACCTCACTTCATTCGTGACTGGCTGCAAGTTTGGCATGATGACTACTCGCGAGTCT
TCATCAAGTCACTTGGTCTCACGAGCAATGGCACTGGCCGCCACGGAGACTGGAGGCATCGACTTGCTCTTCCAC
ACCAATACCGAGTCGGGCAAGACGGACGACCTGGCCAGTGATTCCAACGTCAATATTGCTTTTATCAATTCATCG
GGAGAGTGGGCGTCGATATCAGGTGAAGCCACCATTGTCACAGACCGCGAACTCGTAAAGAAGCACTACAGTTCA
GCCCTCAAAGCTTGGCTCGGCGATTTGGGCGATGGCAAGCACGATGGCTCGGCAAATGATCCCCGAATTGGCGTC
ATTCGAGTCAAGATGTTCACAGCGACATACTCGCTCTGTGCCAGAAACTTGATTGGACGTGCGTCAGAAGTCGTC
GAGGGCGCCATAACTGGCAAGCCTGCCCAGCCGAATCGTTTGAGACAGATTTCAGCATCCGAAGTTTCGGAGTGG
CGCACCCTTAATAAGTGA
Transcript >OphauG2|6918
ATGTCCTTCTCAAATACTTCAGTCGGCGACAAGCCTGCCGATCCTTACAAAAAGGCCAACCTGGAGGAAATCGAC
ACCAAGACCAAGGTTCAAGACCTCACTTCATTCGTGACTGGCTGCAAGTTTGGCATGATGACTACTCGCGAGTCT
TCATCAAGTCACTTGGTCTCACGAGCAATGGCACTGGCCGCCACGGAGACTGGAGGCATCGACTTGCTCTTCCAC
ACCAATACCGAGTCGGGCAAGACGGACGACCTGGCCAGTGATTCCAACGTCAATATTGCTTTTATCAATTCATCG
GGAGAGTGGGCGTCGATATCAGGTGAAGCCACCATTGTCACAGACCGCGAACTCGTAAAGAAGCACTACAGTTCA
GCCCTCAAAGCTTGGCTCGGCGATTTGGGCGATGGCAAGCACGATGGCTCGGCAAATGATCCCCGAATTGGCGTC
ATTCGAGTCAAGATGTTCACAGCGACATACTCGCTCTGTGCCAGAAACTTGATTGGACGTGCGTCAGAAGTCGTC
GAGGGCGCCATAACTGGCAAGCCTGCCCAGCCGAATCGTTTGAGACAGATTTCAGCATCCGAAGTTTCGGAGTGG
CGCACCCTTAATAAGTGA
Gene >OphauG2|6918
ATGTCCTTCTCAAATACTTCAGTCGGCGACAAGCCTGCCGATCCTTACAAAAAGGCCAACCTGGAGGAAATCGAC
ACCAAGACCAAGGTTCAAGACCTCACTTCATTCGTGACTGGCTGCAAGTTTGGCATGATGACTACTCGCGAGTCT
TCATCAAGTCACTTGGTCTCACGAGCAATGGCACTGGCCGCCACGGTAAGCCGCTATCTCGTACTTGGTCTATAG
CCTTGATCAAGTCATGATGCACCTGACAAGACATATCACGCGCTGCAGGAGACTGGAGGCATCGACTTGCTCTTC
CACACCAATACCGAGTCGGGCAAGACGGACGACCTGGCCAGTGATTCCAACGTCAATATTGCTTTTATCAATTCA
TCGGGAGAGTGGGCGTCGATATCAGGTGAAGCCACCATTGTCACAGACCGCGAACTCGTAAAGAAGCACTACAGT
TCAGCCCTCAAAGCTTGGCTCGGCGATTTGGGCGATGGCAAGCACGATGGCTCGGCAAATGATCCCCGAATTGGC
GTCATTCGAGTCAAGATGTTCACAGCGACATACTCGCTCTGTGCCAGAAACTTGATTGGACGTGCGTCAGAAGTC
GTCGAGGGCGCCATAACTGGCAAGCCTGCCCAGCCGAATCGTTTGAGACAGATTTCAGCATCCGAAGTTTCGGAG
TGGCGCACCCTTAATAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail