Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6903
Gene name
LocationContig_751:7497..8876
Strand-
Gene length (bp)1379
Transcript length (bp)1071
Coding sequence length (bp)1071
Protein length (aa) 357

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.4E-20 82 151

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10422|YDC1_SCHPO Uncharacterized RNA-binding protein C25G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25G10.01 PE=1 SV=1 73 231 1.0E-25
sp|P62997|TRA2B_RAT Transformer-2 protein homolog beta OS=Rattus norvegicus GN=Tra2b PE=1 SV=1 77 228 2.0E-15
sp|P62996|TRA2B_MOUSE Transformer-2 protein homolog beta OS=Mus musculus GN=Tra2b PE=1 SV=1 77 228 2.0E-15
sp|P62995|TRA2B_HUMAN Transformer-2 protein homolog beta OS=Homo sapiens GN=TRA2B PE=1 SV=1 77 228 2.0E-15
sp|Q3ZBT6|TRA2B_BOVIN Transformer-2 protein homolog beta OS=Bos taurus GN=TRA2B PE=2 SV=1 77 228 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10422|YDC1_SCHPO Uncharacterized RNA-binding protein C25G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25G10.01 PE=1 SV=1 73 231 1.0E-25
sp|P62997|TRA2B_RAT Transformer-2 protein homolog beta OS=Rattus norvegicus GN=Tra2b PE=1 SV=1 77 228 2.0E-15
sp|P62996|TRA2B_MOUSE Transformer-2 protein homolog beta OS=Mus musculus GN=Tra2b PE=1 SV=1 77 228 2.0E-15
sp|P62995|TRA2B_HUMAN Transformer-2 protein homolog beta OS=Homo sapiens GN=TRA2B PE=1 SV=1 77 228 2.0E-15
sp|Q3ZBT6|TRA2B_BOVIN Transformer-2 protein homolog beta OS=Bos taurus GN=TRA2B PE=2 SV=1 77 228 2.0E-15
sp|Q84TH4|SR45A_ARATH Serine/arginine-rich splicing factor SR45a OS=Arabidopsis thaliana GN=SR45A PE=1 SV=1 75 171 8.0E-14
sp|P19018|TRA2_DROME Transformer-2 sex-determining protein OS=Drosophila melanogaster GN=tra2 PE=1 SV=1 84 210 9.0E-14
sp|O02008|TRA2_DROVI Transformer-2 sex-determining protein OS=Drosophila virilis GN=tra2 PE=3 SV=1 84 180 6.0E-13
sp|Q54Y98|TRA2_DICDI Transformer-2 protein homolog OS=Dictyostelium discoideum GN=tra2 PE=3 SV=1 75 185 2.0E-12
sp|Q8RWN5|RZ1C_ARATH Glycine-rich RNA-binding protein RZ1C OS=Arabidopsis thaliana GN=RZ1C PE=1 SV=1 75 156 3.0E-10
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 81 157 8.0E-10
sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 82 159 8.0E-10
sp|Q8LPQ9|FPA_ARATH Flowering time control protein FPA OS=Arabidopsis thaliana GN=FPA PE=2 SV=2 80 161 1.0E-09
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 82 159 1.0E-09
sp|Q6PFR5|TRA2A_MOUSE Transformer-2 protein homolog alpha OS=Mus musculus GN=Tra2a PE=1 SV=1 77 173 2.0E-09
sp|Q13595|TRA2A_HUMAN Transformer-2 protein homolog alpha OS=Homo sapiens GN=TRA2A PE=1 SV=1 77 173 2.0E-09
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 80 186 2.0E-09
sp|Q6IRQ4|RBMX_XENLA RNA-binding motif protein, X chromosome OS=Xenopus laevis GN=rbmx PE=2 SV=1 81 165 3.0E-09
sp|Q8N7X1|RMXL3_HUMAN RNA-binding motif protein, X-linked-like-3 OS=Homo sapiens GN=RBMXL3 PE=2 SV=2 82 188 4.0E-09
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 82 168 4.0E-09
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 80 162 4.0E-09
sp|Q9CAE4|U1131_ARATH U11/U12 small nuclear ribonucleoprotein 31 kDa protein OS=Arabidopsis thaliana GN=SNRNP31 PE=2 SV=1 80 156 7.0E-09
sp|Q9V535|RBM8A_DROME RNA-binding protein 8A OS=Drosophila melanogaster GN=tsu PE=1 SV=1 69 153 7.0E-09
sp|P0C8Z4|RMXL3_PANTR RNA-binding motif protein, X-linked-like-3 OS=Pan troglodytes GN=RBMXL3 PE=3 SV=1 82 188 8.0E-09
sp|Q09511|RSP4_CAEEL Probable splicing factor, arginine/serine-rich 4 OS=Caenorhabditis elegans GN=rsp-4 PE=3 SV=1 76 161 1.0E-08
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 82 159 1.0E-08
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 82 159 1.0E-08
sp|Q5D018|RBM8A_DANRE RNA-binding protein 8A OS=Danio rerio GN=rbm8a PE=2 SV=1 58 153 1.0E-08
sp|P30352|SRSF2_CHICK Serine/arginine-rich splicing factor 2 OS=Gallus gallus GN=SRSF2 PE=2 SV=1 80 169 1.0E-08
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 82 168 1.0E-08
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 82 156 1.0E-08
sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 82 156 2.0E-08
sp|A5A6H4|ROA1_PANTR Heterogeneous nuclear ribonucleoprotein A1 OS=Pan troglodytes GN=HNRNPA1 PE=2 SV=1 82 174 2.0E-08
sp|P49312|ROA1_MOUSE Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus GN=Hnrnpa1 PE=1 SV=2 82 174 2.0E-08
sp|P09867|ROA1_BOVIN Heterogeneous nuclear ribonucleoprotein A1 OS=Bos taurus GN=HNRNPA1 PE=1 SV=2 82 174 2.0E-08
sp|P04256|ROA1_RAT Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus GN=Hnrnpa1 PE=1 SV=3 82 174 2.0E-08
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 82 159 2.0E-08
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 82 159 2.0E-08
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 82 159 2.0E-08
sp|Q28521|ROA1_MACMU Heterogeneous nuclear ribonucleoprotein A1 OS=Macaca mulatta GN=HNRNPA1 PE=2 SV=3 82 174 2.0E-08
sp|Q9CWZ3|RBM8A_MOUSE RNA-binding protein 8A OS=Mus musculus GN=Rbm8a PE=1 SV=3 79 154 3.0E-08
sp|Q27W01|RBM8A_RAT RNA-binding protein 8A OS=Rattus norvegicus GN=Rbm8a PE=1 SV=1 79 153 3.0E-08
sp|Q9Y5S9|RBM8A_HUMAN RNA-binding protein 8A OS=Homo sapiens GN=RBM8A PE=1 SV=1 79 153 3.0E-08
sp|Q3ZCE8|RBM8A_BOVIN RNA-binding protein 8A OS=Bos taurus GN=RBM8A PE=2 SV=2 79 153 3.0E-08
sp|P09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5 82 174 3.0E-08
sp|B5DGI7|RBM8A_SALSA RNA-binding protein 8A OS=Salmo salar GN=rbm8a PE=2 SV=1 79 154 3.0E-08
sp|Q32P51|RA1L2_HUMAN Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens GN=HNRNPA1L2 PE=2 SV=2 82 174 4.0E-08
sp|Q4V898|RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus GN=Rbmx PE=1 SV=1 82 158 4.0E-08
sp|Q4R7F0|RBMX_MACFA RNA-binding motif protein, X chromosome OS=Macaca fascicularis GN=RBMX PE=2 SV=1 82 158 4.0E-08
sp|O93235|CIRBA_XENLA Cold-inducible RNA-binding protein A OS=Xenopus laevis GN=cirbp-a PE=1 SV=2 82 156 4.0E-08
sp|Q91VM5|RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus GN=Rbmxl1 PE=2 SV=1 82 158 5.0E-08
sp|A5A6M3|RBMX_PANTR RNA-binding motif protein, X chromosome OS=Pan troglodytes GN=RBMX PE=2 SV=1 82 158 5.0E-08
sp|P38159|RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens GN=RBMX PE=1 SV=3 82 158 5.0E-08
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 69 153 5.0E-08
sp|Q14151|SAFB2_HUMAN Scaffold attachment factor B2 OS=Homo sapiens GN=SAFB2 PE=1 SV=1 56 157 5.0E-08
sp|Q9WV02|RBMX_MOUSE RNA-binding motif protein, X chromosome OS=Mus musculus GN=Rbmx PE=1 SV=1 82 158 5.0E-08
sp|Q06A98|SRSF2_PIG Serine/arginine-rich splicing factor 2 OS=Sus scrofa GN=SRSF2 PE=2 SV=1 80 161 6.0E-08
sp|Q6PDU1|SRSF2_RAT Serine/arginine-rich splicing factor 2 OS=Rattus norvegicus GN=Srsf2 PE=1 SV=3 80 161 6.0E-08
sp|Q62093|SRSF2_MOUSE Serine/arginine-rich splicing factor 2 OS=Mus musculus GN=Srsf2 PE=1 SV=4 80 161 6.0E-08
sp|Q01130|SRSF2_HUMAN Serine/arginine-rich splicing factor 2 OS=Homo sapiens GN=SRSF2 PE=1 SV=4 80 161 6.0E-08
sp|Q3MHR5|SRSF2_BOVIN Serine/arginine-rich splicing factor 2 OS=Bos taurus GN=SRSF2 PE=2 SV=3 80 161 6.0E-08
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 82 156 6.0E-08
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 80 162 6.0E-08
sp|O22703|RZ1B_ARATH Glycine-rich RNA-binding protein RZ1B OS=Arabidopsis thaliana GN=RZ1B PE=2 SV=1 77 156 6.0E-08
sp|Q6DJI9|ZCRB1_XENLA Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Xenopus laevis GN=zcrb1 PE=2 SV=1 74 157 7.0E-08
sp|Q5R1W5|SRSF2_PANTR Serine/arginine-rich splicing factor 2 OS=Pan troglodytes GN=SRSF2 PE=2 SV=3 80 161 8.0E-08
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 82 153 8.0E-08
sp|Q9BRL6|SRSF8_HUMAN Serine/arginine-rich splicing factor 8 OS=Homo sapiens GN=SRSF8 PE=1 SV=1 71 157 9.0E-08
sp|P17130|ROA1_XENLA Heterogeneous nuclear ribonucleoproteins A1 homolog OS=Xenopus laevis GN=hnrnpa1 PE=2 SV=1 82 174 9.0E-08
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 77 153 1.0E-07
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 80 158 1.0E-07
sp|Q925G0|RBM3_RAT RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 82 156 1.0E-07
sp|Q43472|GRP_HORVU Glycine-rich RNA-binding protein blt801 OS=Hordeum vulgare GN=blt801 PE=1 SV=1 82 161 1.0E-07
sp|P84586|RMXRL_RAT RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus GN=Rbmxrtl PE=1 SV=1 82 159 1.0E-07
sp|Q99069|GRP1_SORBI Glycine-rich RNA-binding protein 1 (Fragment) OS=Sorghum bicolor GN=GRP1 PE=2 SV=1 100 157 2.0E-07
sp|O01671|SXL_MEGSC Sex-lethal homolog OS=Megaselia scalaris GN=SXL PE=2 SV=3 80 198 2.0E-07
sp|Q57014|RBPA_SYNY3 Putative RNA-binding protein RbpA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rbpA PE=3 SV=3 81 157 2.0E-07
sp|P51990|RO22_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 2 OS=Xenopus laevis PE=2 SV=1 82 174 2.0E-07
sp|Q28BZ1|RBM8A_XENTR RNA-binding protein 8A OS=Xenopus tropicalis GN=rbm8a PE=2 SV=1 58 154 2.0E-07
sp|Q96E39|RMXL1_HUMAN RNA binding motif protein, X-linked-like-1 OS=Homo sapiens GN=RBMXL1 PE=1 SV=1 82 158 2.0E-07
sp|Q9FNR1|RBG3_ARATH Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana GN=RBG3 PE=2 SV=1 80 157 2.0E-07
sp|P51992|RO32_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 2 OS=Xenopus laevis PE=2 SV=1 82 212 2.0E-07
sp|Q4R813|RMXL2_MACFA RNA-binding motif protein, X-linked-like-2 OS=Macaca fascicularis GN=RBMXL2 PE=2 SV=1 81 158 2.0E-07
sp|P51968|RO31_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 1 OS=Xenopus laevis PE=2 SV=1 82 212 2.0E-07
sp|D4AE41|RMXL1_RAT RNA binding motif protein, X-linked-like-1 OS=Rattus norvegicus GN=Rbmxl1 PE=3 SV=1 82 158 2.0E-07
sp|Q6PH90|RB8AB_XENLA RNA-binding protein 8A-B OS=Xenopus laevis GN=rbm8a-b PE=2 SV=1 58 154 2.0E-07
sp|Q29RT0|RBMX_BOVIN RNA-binding motif protein, X chromosome OS=Bos taurus GN=RBMX PE=2 SV=1 81 158 2.0E-07
sp|Q9TTV2|ROA2_SAGOE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Saguinus oedipus GN=HNRNPA2B1 PE=1 SV=1 82 174 3.0E-07
sp|Q9DF42|RB8AA_XENLA RNA-binding protein 8A-A OS=Xenopus laevis GN=rbm8a-a PE=2 SV=1 58 154 3.0E-07
sp|Q80YR5|SAFB2_MOUSE Scaffold attachment factor B2 OS=Mus musculus GN=Safb2 PE=1 SV=2 56 157 3.0E-07
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 80 157 3.0E-07
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 80 157 3.0E-07
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 80 157 4.0E-07
sp|O75526|RMXL2_HUMAN RNA-binding motif protein, X-linked-like-2 OS=Homo sapiens GN=RBMXL2 PE=1 SV=3 81 158 4.0E-07
sp|Q5R452|SAFB1_PONAB Scaffold attachment factor B1 OS=Pongo abelii GN=SAFB PE=2 SV=1 61 157 4.0E-07
sp|Q15424|SAFB1_HUMAN Scaffold attachment factor B1 OS=Homo sapiens GN=SAFB PE=1 SV=4 61 157 4.0E-07
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 82 178 4.0E-07
sp|P0C1I6|PPIL4_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 4 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp13 PE=3 SV=1 78 228 4.0E-07
sp|P51989|RO21_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 1 OS=Xenopus laevis PE=2 SV=1 82 174 5.0E-07
sp|Q8TBF4|ZCRB1_HUMAN Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Homo sapiens GN=ZCRB1 PE=1 SV=2 74 151 5.0E-07
sp|Q2HJ60|ROA2_BOVIN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Bos taurus GN=HNRNPA2B1 PE=2 SV=1 82 174 5.0E-07
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 80 207 5.0E-07
sp|P48810|RB87F_DROME Heterogeneous nuclear ribonucleoprotein 87F OS=Drosophila melanogaster GN=Hrb87F PE=2 SV=2 82 162 5.0E-07
sp|P51991|ROA3_HUMAN Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens GN=HNRNPA3 PE=1 SV=2 82 170 5.0E-07
sp|Q6URK4|ROA3_RAT Heterogeneous nuclear ribonucleoprotein A3 OS=Rattus norvegicus GN=Hnrnpa3 PE=1 SV=1 82 170 6.0E-07
sp|Q8BG05|ROA3_MOUSE Heterogeneous nuclear ribonucleoprotein A3 OS=Mus musculus GN=Hnrnpa3 PE=1 SV=1 82 170 6.0E-07
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 80 157 6.0E-07
sp|Q9WX39|RBPF_NOSS1 Putative RNA-binding protein RbpF OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpF PE=3 SV=3 81 157 6.0E-07
sp|Q5SP50|ZCRB1_DANRE Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Danio rerio GN=zcrb1 PE=2 SV=1 74 151 7.0E-07
sp|Q9LIN3|RZ1A_ARATH Glycine-rich RNA-binding protein RZ1A OS=Arabidopsis thaliana GN=RZ1A PE=1 SV=1 77 157 7.0E-07
sp|A7VJC2|ROA2_RAT Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Rattus norvegicus GN=Hnrnpa2b1 PE=1 SV=1 82 174 7.0E-07
sp|Q60990|RBY1B_MOUSE RNA-binding motif protein, Y chromosome, family 1 member B OS=Mus musculus GN=Rbmy1b PE=2 SV=3 82 158 7.0E-07
sp|O88569|ROA2_MOUSE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Mus musculus GN=Hnrnpa2b1 PE=1 SV=2 82 174 7.0E-07
sp|P22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens GN=HNRNPA2B1 PE=1 SV=2 82 174 7.0E-07
sp|O35698|RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus GN=Rbmy1a1 PE=1 SV=2 76 158 8.0E-07
sp|Q5ARI5|PPIL4_EMENI Peptidyl-prolyl cis-trans isomerase-like 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp6 PE=3 SV=1 78 276 8.0E-07
sp|Q5RBU8|ROA2_PONAB Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Pongo abelii GN=HNRNPA2B1 PE=2 SV=1 82 174 9.0E-07
sp|Q9FMG4|SC35_ARATH Serine/arginine-rich splicing factor SC35 OS=Arabidopsis thaliana GN=SC35 PE=1 SV=1 81 157 9.0E-07
sp|P92964|SRS31_ARATH Serine/arginine-rich splicing factor RS31 OS=Arabidopsis thaliana GN=RS31 PE=1 SV=2 76 156 9.0E-07
sp|Q56JZ7|ZCRB1_BOVIN Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Bos taurus GN=ZCRB1 PE=2 SV=1 74 151 9.0E-07
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 80 164 9.0E-07
sp|P07909|ROA1_DROME Heterogeneous nuclear ribonucleoprotein A1 OS=Drosophila melanogaster GN=Hrb98DE PE=2 SV=1 82 162 1.0E-06
sp|O88453|SAFB1_RAT Scaffold attachment factor B1 OS=Rattus norvegicus GN=Safb PE=1 SV=2 61 157 1.0E-06
sp|P21522|ROA1_SCHAM Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog OS=Schistocerca americana GN=HNRNP PE=2 SV=1 69 163 1.0E-06
sp|Q15717|ELAV1_HUMAN ELAV-like protein 1 OS=Homo sapiens GN=ELAVL1 PE=1 SV=2 80 157 1.0E-06
sp|P70372|ELAV1_MOUSE ELAV-like protein 1 OS=Mus musculus GN=Elavl1 PE=1 SV=2 80 157 1.0E-06
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 80 157 1.0E-06
sp|Q44556|RBPD_NOSS1 Putative RNA-binding protein RbpD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpD PE=3 SV=3 81 157 1.0E-06
sp|Q9SD61|C3H42_ARATH Zinc finger CCCH domain-containing protein 42 OS=Arabidopsis thaliana GN=At3g47120 PE=2 SV=1 82 156 1.0E-06
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 80 162 1.0E-06
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 80 162 1.0E-06
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 80 157 1.0E-06
sp|Q02926|RB97D_DROME Ribonucleoprotein RB97D OS=Drosophila melanogaster GN=Rb97D PE=2 SV=1 82 162 2.0E-06
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 82 153 2.0E-06
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 80 157 2.0E-06
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 82 153 2.0E-06
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 80 162 2.0E-06
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 82 153 2.0E-06
sp|Q96DH6|MSI2H_HUMAN RNA-binding protein Musashi homolog 2 OS=Homo sapiens GN=MSI2 PE=1 SV=1 67 165 2.0E-06
sp|D3YXK2|SAFB1_MOUSE Scaffold attachment factor B1 OS=Mus musculus GN=Safb PE=1 SV=2 71 157 2.0E-06
sp|A6NDE4|RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens GN=RBMY1B PE=2 SV=2 75 158 2.0E-06
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 80 162 2.0E-06
sp|Q44554|RBPB_NOSS1 Putative RNA-binding protein RbpB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpB PE=3 SV=3 81 157 2.0E-06
sp|Q920Q6|MSI2H_MOUSE RNA-binding protein Musashi homolog 2 OS=Mus musculus GN=Msi2 PE=1 SV=1 67 165 2.0E-06
sp|P0DJD3|RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens GN=RBMY1A1 PE=1 SV=1 75 158 2.0E-06
sp|A6NEQ0|RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens GN=RBMY1E PE=2 SV=1 75 158 2.0E-06
sp|P0C7P1|RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens GN=RBMY1D PE=2 SV=1 75 158 2.0E-06
sp|Q10B98|C3H25_ORYSJ Zinc finger CCCH domain-containing protein 25 OS=Oryza sativa subsp. japonica GN=Os03g0826400 PE=2 SV=1 82 156 2.0E-06
sp|Q43349|CP29A_ARATH 29 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP29A PE=2 SV=2 64 153 3.0E-06
sp|Q91903|ELAV2_XENLA ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE=1 SV=2 80 191 3.0E-06
sp|P0DJD4|RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens GN=RBMY1C PE=1 SV=1 75 158 3.0E-06
sp|Q8R3C6|RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus musculus GN=Rbm19 PE=1 SV=1 78 184 3.0E-06
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 72 158 3.0E-06
sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 80 157 4.0E-06
sp|O04425|FCA_ARATH Flowering time control protein FCA OS=Arabidopsis thaliana GN=FCA PE=1 SV=2 82 168 4.0E-06
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 80 157 4.0E-06
sp|Q61474|MSI1H_MOUSE RNA-binding protein Musashi homolog 1 OS=Mus musculus GN=Msi1 PE=1 SV=1 80 165 4.0E-06
sp|Q9Y4C8|RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens GN=RBM19 PE=1 SV=3 78 159 4.0E-06
sp|Q8K3P4|MSI1H_RAT RNA-binding protein Musashi homolog 1 OS=Rattus norvegicus GN=Msi1 PE=2 SV=1 80 165 4.0E-06
sp|Q8R0F5|RBMX2_MOUSE RNA-binding motif protein, X-linked 2 OS=Mus musculus GN=Rbmx2 PE=1 SV=1 82 153 4.0E-06
sp|Q03878|GRP1_DAUCA Glycine-rich RNA-binding protein OS=Daucus carota PE=2 SV=1 82 157 4.0E-06
sp|O43347|MSI1H_HUMAN RNA-binding protein Musashi homolog 1 OS=Homo sapiens GN=MSI1 PE=1 SV=1 80 165 5.0E-06
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 79 158 5.0E-06
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 80 207 5.0E-06
sp|Q91903|ELAV2_XENLA ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE=1 SV=2 67 157 6.0E-06
sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 82 127 6.0E-06
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 80 163 6.0E-06
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 80 163 6.0E-06
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 80 163 6.0E-06
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 80 163 6.0E-06
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 80 163 6.0E-06
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 80 163 6.0E-06
sp|Q9Y388|RBMX2_HUMAN RNA-binding motif protein, X-linked 2 OS=Homo sapiens GN=RBMX2 PE=1 SV=2 82 156 6.0E-06
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 80 162 6.0E-06
sp|Q9JJ54|HNRPD_RAT Heterogeneous nuclear ribonucleoprotein D0 OS=Rattus norvegicus GN=Hnrnpd PE=1 SV=2 82 171 7.0E-06
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 80 157 7.0E-06
sp|Q60900|ELAV3_MOUSE ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1 80 157 7.0E-06
sp|Q76LC6|RBM24_DANRE RNA-binding protein 24 OS=Danio rerio GN=rbm24 PE=2 SV=1 80 177 7.0E-06
sp|D3Z4I3|RBM24_MOUSE RNA-binding protein 24 OS=Mus musculus GN=Rbm24 PE=3 SV=1 80 177 8.0E-06
sp|Q14576|ELAV3_HUMAN ELAV-like protein 3 OS=Homo sapiens GN=ELAVL3 PE=2 SV=3 80 157 8.0E-06
sp|Q9I8B3|RB24B_XENLA RNA-binding protein 24-B OS=Xenopus laevis GN=rbm24-b PE=2 SV=1 80 177 8.0E-06
sp|Q9UUE4|PPIL4_SCHPO Peptidyl-prolyl cis-trans isomerase cyp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp6 PE=1 SV=1 78 283 9.0E-06
sp|Q5ZI72|HNRDL_CHICK Heterogeneous nuclear ribonucleoprotein D-like OS=Gallus gallus GN=HNRNPDL PE=2 SV=1 58 170 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6903
MDYEAAGGDRYDEEATRYERDNRSASPRPARDDNDGLRRRSASPNGNTDFCNYFLLYRIRASKDMLSSKDDDDGA
VNPGSNLFVTGIHPRLTEGDVAKMFEKYGDVEKCQIMRDPHTKESRGFGFVKMVTSEQAEAAKEGLQGEQIEGRT
LSIEKARRARPRTPTPGKYFGPPKREPRGRFDDRRRGGYGGSAGAGYGREDYRYRGYDRGYGSDRRNDDRGYDRG
GYRDDRRYDDRGYGRDYERGYERRDRGDDYYGRDRYGGREDRDRYGGRGNAGGYERDRYDRPADRDPTRNREPLG
GGSGYGDSTSRGDTRESYGESVLAGEWSLSARTVRLAFNAKRVRASPSAVRFWVFV*
Coding >OphauG2|6903
ATGGATTATGAGGCTGCAGGTGGCGATCGGTACGACGAAGAGGCTACGAGGTATGAGCGCGATAATCGAAGCGCC
TCTCCTCGCCCAGCTCGCGATGACAACGATGGCCTTCGTCGTCGCTCGGCATCCCCAAATGGCAACACTGACTTT
TGTAACTATTTCTTACTATATCGCATAAGGGCCTCTAAGGACATGCTGTCGTCCAAGGATGACGATGATGGCGCC
GTGAATCCTGGTTCTAACCTCTTCGTCACTGGAATTCATCCTCGCCTGACGGAGGGGGATGTTGCAAAAATGTTC
GAAAAATATGGCGACGTTGAAAAGTGCCAGATCATGCGTGATCCGCACACCAAAGAGTCTCGCGGCTTTGGCTTC
GTGAAAATGGTCACTTCCGAACAGGCCGAGGCCGCCAAAGAGGGTCTCCAGGGCGAACAGATCGAGGGCCGCACT
CTAAGCATTGAAAAGGCTCGTCGTGCTCGCCCCCGTACTCCAACGCCTGGCAAATATTTTGGACCGCCCAAACGT
GAACCCCGTGGTCGTTTCGATGACCGCCGACGTGGTGGCTACGGTGGCAGCGCCGGCGCTGGTTATGGGCGTGAA
GATTATCGTTATCGTGGATACGATCGAGGCTATGGTTCTGACCGCAGAAATGATGATCGCGGCTACGATCGCGGT
GGATATCGTGATGATCGACGCTACGATGATCGTGGTTATGGCCGCGACTATGAGCGAGGTTATGAACGCCGGGAC
CGAGGTGACGACTACTATGGCAGAGACCGTTATGGTGGACGCGAGGATCGGGACCGCTATGGAGGTCGAGGTAAT
GCAGGCGGTTACGAACGCGACCGCTACGACCGTCCCGCAGATCGTGATCCTACTCGCAATCGCGAGCCCCTCGGA
GGTGGCTCTGGCTATGGCGATTCTACTTCCCGCGGTGATACTCGCGAGTCTTATGGAGAAAGCGTTCTCGCCGGC
GAGTGGTCCTTATCGGCAAGAACTGTTCGCCTTGCGTTTAATGCCAAGCGTGTAAGGGCATCTCCTTCAGCAGTT
CGCTTCTGGGTCTTTGTCTAG
Transcript >OphauG2|6903
ATGGATTATGAGGCTGCAGGTGGCGATCGGTACGACGAAGAGGCTACGAGGTATGAGCGCGATAATCGAAGCGCC
TCTCCTCGCCCAGCTCGCGATGACAACGATGGCCTTCGTCGTCGCTCGGCATCCCCAAATGGCAACACTGACTTT
TGTAACTATTTCTTACTATATCGCATAAGGGCCTCTAAGGACATGCTGTCGTCCAAGGATGACGATGATGGCGCC
GTGAATCCTGGTTCTAACCTCTTCGTCACTGGAATTCATCCTCGCCTGACGGAGGGGGATGTTGCAAAAATGTTC
GAAAAATATGGCGACGTTGAAAAGTGCCAGATCATGCGTGATCCGCACACCAAAGAGTCTCGCGGCTTTGGCTTC
GTGAAAATGGTCACTTCCGAACAGGCCGAGGCCGCCAAAGAGGGTCTCCAGGGCGAACAGATCGAGGGCCGCACT
CTAAGCATTGAAAAGGCTCGTCGTGCTCGCCCCCGTACTCCAACGCCTGGCAAATATTTTGGACCGCCCAAACGT
GAACCCCGTGGTCGTTTCGATGACCGCCGACGTGGTGGCTACGGTGGCAGCGCCGGCGCTGGTTATGGGCGTGAA
GATTATCGTTATCGTGGATACGATCGAGGCTATGGTTCTGACCGCAGAAATGATGATCGCGGCTACGATCGCGGT
GGATATCGTGATGATCGACGCTACGATGATCGTGGTTATGGCCGCGACTATGAGCGAGGTTATGAACGCCGGGAC
CGAGGTGACGACTACTATGGCAGAGACCGTTATGGTGGACGCGAGGATCGGGACCGCTATGGAGGTCGAGGTAAT
GCAGGCGGTTACGAACGCGACCGCTACGACCGTCCCGCAGATCGTGATCCTACTCGCAATCGCGAGCCCCTCGGA
GGTGGCTCTGGCTATGGCGATTCTACTTCCCGCGGTGATACTCGCGAGTCTTATGGAGAAAGCGTTCTCGCCGGC
GAGTGGTCCTTATCGGCAAGAACTGTTCGCCTTGCGTTTAATGCCAAGCGTGTAAGGGCATCTCCTTCAGCAGTT
CGCTTCTGGGTCTTTGTCTAG
Gene >OphauG2|6903
ATGGATTATGAGGCTGCAGGTGGCGATCGGTACGACGGTACGTCTCTTATCCTTCTGCCCACTCAATTCTCGATA
TAACGAGCCTCTCTTTCCTCCCTCATCGTTGCATTGTGCCCGGGTTTTCTGTATGCGTTTTGTTCATGTCCTCAT
TCAATATTCTTCCAGAAGAGGCTACGAGGTATGAGCGCGATAATCGAAGCGCCTCTCCTCGCCCAGCTCGCGATG
ACAACGATGGCCTTCGTCGTCGCTCGGCATCCCCAAATGGCAACACTGACTTGTAAGTCTACCAACTGGCGCACA
TGCTCCAATGTATGTTTCCCCTGACAGTTGTAACTATTTCTTACTATATCGCATAAGGGCCTCTAAGGACATGCT
GTCGTCCAAGGATGACGATGATGGCGCCGTGAATCCTGGTTCTAACCTCTTCGTCACTGGAATTCATCCTCGCCT
GACGGAGGGGGATGTTGCAAAAATGTTCGAAAAATATGGCGACGTTGAAAAGTGCCAGATCATGCGTGATCCGCA
CACCAAAGAGTCTCGCGGCTTTGGCTTCGTGAAAATGGTCACTTCCGAACAGGCCGAGGCCGCCAAAGAGGGTCT
CCAGGGCGAACAGATCGAGGGCCGCACTCTAAGCATTGAAAAGGCTCGTCGTGCTCGCCCCCGTACTCCAACGCC
TGGCAAATATTTTGGACCGCCCAAACGTGGTACGCTGCCTCCAAAATACACTCACACATGACTTGTCCCGCTGAT
AACCCACTAGAACCCCGTGGTCGTTTCGATGACCGCCGACGTGGTGGCTACGGTGGCAGCGCCGGCGCTGGTTAT
GGGCGTGAAGATTATCGTTATCGTGGATACGATCGAGGCTATGGTTCTGACCGCAGAAATGATGATCGCGGCTAC
GATCGCGGTGGATATCGTGATGATCGACGCTACGATGATCGTGGTTATGGCCGCGACTATGAGCGAGGTTATGAA
CGCCGGGACCGAGGTGACGACTACTATGGCAGAGACCGTTATGGTGGACGCGAGGATCGGGACCGCTATGGAGGT
CGAGGTAATGCAGGCGGTTACGAACGCGACCGCTACGACCGTCCCGCAGATCGTGATCCTACTCGCAATCGCGAG
CCCCTCGGAGGTGGCTCTGGCTATGGCGATTCTACTTCCCGCGGTGATACTCGCGAGTCTTATGGAGGTTTGGGT
CATTCCAACGTAATATTACAGCGTCGTATACTGATATTTTCAGGCCCTGACCCGACAGTTCGATAGAAAGCGTTC
TCGCCGGCGAGTGGTCCTTATCGGCAAGAACTGTTCGCCTTGCGTTTAATGCCAAGCGTGTAAGGGCATCTCCTT
CAGCAGTTCGCTTCTGGGTCTTTGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail