Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6898
Gene name
LocationContig_75:34146..37241
Strand-
Gene length (bp)3095
Transcript length (bp)2970
Coding sequence length (bp)2970
Protein length (aa) 990

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12868 DUF3824 Domain of unknwon function (DUF3824) 7.0E-01 471 566
PF12868 DUF3824 Domain of unknwon function (DUF3824) 2.9E-05 614 739

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3062
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6898 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2013
Ophiocordyceps camponoti-floridani Ophcf2|06886
Ophiocordyceps camponoti-rufipedis Ophun1|5441
Ophiocordyceps kimflemingae Ophio5|4513
Ophiocordyceps subramaniannii Hirsu2|5310

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6898
MAESYRGSRYYAPARDRDRNSDSEDDRIRSSTTVTRYKWTPARAVDRYQDDDRRSRFSPRTSGDLADPPRSAYES
YAGDRPRAMYYDRDVVERDARHEPDRSRPVYETRDGDRDWNRRLYRYDDDYKVEKKYEDRFDDDHGHEIERYRKE
TEYFAPAEPPPAPVIIRQQAPEPQKIIVQEAPSTPIIVPRQQPGVLVVRDREQDRDLVRRDREPYDQEYYWRHER
RDVGPYRGERDYALSRYERRHRRDDDNSWYSDDADQDYFLRRTYVRRERSESPHRHRRQLAEGALAGAGISALMS
SRRDSYGELQENRGRKVLAGAALGALGSEALRRARSAYGDSWLDDHASPEGHSRLRRGLGLAAVALAAAGAAKYY
EASKVEKEEAHRGRSRTRGGYYSHDEYSRSVSRLSHSHSHSHSPSPRRPRSRRRSLSTIAKTALGTAATAGIIKH
MSKSRSKSHSRHGSPSRSKSRSKSKLRRGAEIAGVAAAAGMANRLWKDHKDKKEARRDRSVSQDERESRRRWRPK
GSSRDRSISRSPSRSRSMARSPPSPIGADPELGLVEYGHEPLPPEHPSAAERHYDSQSEDWRPRPRRRHARSVSS
SSSMSDPKPKPRHSRSKMAAAATAAAAAGTAAMGIKEFKDRKDRERREKRSRERRSREADEDRTRFESEQRRDQH
LDRLGKRRPHSPPTASGGAYYPPYPSTSSSGQGEVPYRQFPEDSSSAHNQYQQFVPQDYTGYVPPPPPPPGPPPP
PEPGMRGDGYPPVAPGMPPGPPPPAGPHPGENYPPDHVSDHFHRHHRRGRGAAHDGVMPKDDDASNPETATAPRS
VSFIPLSPRSSQTMQRHKEQQAASTKAALERTRDEKTGMKRQGDQTHGRPGLERQSGHDRAAASRRALPEGEDEV
ELLPDRFDAQGKPMDTSGRLVGHDGWTIRRGEFERPARHAGDWHVKGSWQAASTDAQAMDRLVSDVTDVLAGQQN
WAAVLGKVLEAGLL*
Coding >OphauG2|6898
ATGGCCGAATCCTACAGAGGCTCGAGATATTACGCTCCGGCCAGAGATCGCGATCGCAACAGCGACTCGGAAGAC
GATCGCATCCGCTCCTCCACCACCGTCACCCGCTACAAGTGGACGCCCGCCCGTGCCGTTGACCGCTACCAAGAC
GACGACCGCCGCTCTCGCTTCTCGCCTCGCACCTCGGGCGACCTGGCCGACCCGCCGCGCTCTGCCTACGAGTCG
TATGCTGGTGACCGCCCTCGTGCAATGTACTACGACCGAGACGTGGTGGAGCGCGATGCTCGCCACGAGCCCGAC
CGCTCTCGACCCGTTTATGAGACCCGCGACGGAGACCGTGACTGGAACCGCCGCCTATACCGCTACGACGACGAC
TACAAGGTTGAGAAAAAGTACGAGGATCGCTTCGACGACGACCATGGCCATGAGATTGAGCGCTACCGCAAGGAG
ACGGAGTATTTCGCCCCTGCCGAACCCCCCCCTGCCCCCGTCATCATCCGCCAGCAGGCTCCCGAGCCTCAAAAG
ATCATTGTCCAAGAGGCCCCATCCACCCCCATCATTGTGCCCCGTCAACAGCCTGGCGTCCTTGTCGTCCGGGAC
CGCGAACAAGACCGTGACCTTGTTCGCCGTGACCGTGAACCCTACGACCAAGAGTACTACTGGCGTCACGAGCGC
CGAGACGTTGGGCCCTACCGTGGCGAGCGCGACTATGCTCTCTCGCGCTATGAGCGCCGCCATCGTCGCGACGAC
GATAACAGCTGGTACAGCGACGACGCCGACCAAGACTACTTTCTCCGCCGCACATACGTCCGCCGAGAGCGCAGT
GAAAGTCCCCATCGCCACCGGCGCCAGCTTGCCGAGGGCGCCCTTGCTGGTGCCGGCATCTCGGCTCTCATGTCG
TCTCGCCGAGACTCGTATGGCGAATTGCAAGAAAACCGCGGCCGCAAAGTCCTGGCCGGCGCTGCGCTGGGTGCC
CTCGGCTCAGAAGCCCTCCGACGTGCTCGGAGTGCTTACGGGGATAGCTGGTTGGACGACCACGCTTCACCAGAG
GGCCACTCACGACTAAGAAGAGGTCTTGGTCTTGCTGCTGTCGCTCTGGCCGCCGCCGGCGCTGCCAAGTACTAC
GAGGCCAGCAAGGTGGAAAAGGAAGAGGCTCACCGCGGCCGCAGCCGGACAAGGGGTGGCTACTACTCCCATGAT
GAGTATTCCCGCTCTGTTTCTCGCCTCTCTCACTCTCACTCTCACTCTCACTCTCCTTCTCCTCGTCGTCCTCGC
TCGCGCCGCCGCAGCCTGTCAACCATTGCCAAGACGGCCCTAGGCACAGCTGCCACGGCTGGAATCATCAAGCAC
ATGAGCAAGTCCAGGTCCAAGTCTCACTCGCGCCACGGCAGCCCCTCTCGGAGCAAGTCTCGTAGCAAGTCGAAG
CTTCGTCGCGGCGCTGAAATTGCTGGCGTTGCCGCTGCTGCTGGCATGGCCAACAGGCTTTGGAAGGACCACAAG
GACAAGAAGGAGGCGCGCCGCGACCGCAGCGTCAGCCAAGACGAGCGCGAATCCCGTCGTCGATGGCGACCCAAG
GGCTCAAGCAGAGATCGCAGCATCAGCCGCAGCCCGAGTCGGAGCAGGTCCATGGCCAGATCCCCTCCGTCACCG
ATAGGGGCTGATCCTGAGCTAGGCTTAGTTGAGTACGGGCACGAGCCTCTGCCGCCGGAGCATCCATCTGCCGCC
GAGCGGCATTATGATTCTCAAAGCGAGGATTGGAGGCCCCGGCCGAGGCGACGCCATGCCCGCTCAGTGTCATCG
TCGTCGTCCATGTCGGACCCGAAACCGAAGCCAAGACACAGCAGAAGCAAAATGGCTGCCGCTGCCACTGCCGCT
GCGGCAGCTGGCACGGCCGCCATGGGCATCAAGGAATTCAAGGATCGAAAGGATAGGGAGAGGCGGGAGAAGAGG
TCACGCGAAAGGAGATCGAGAGAGGCAGACGAGGACAGGACAAGATTCGAATCAGAGCAGAGGCGCGACCAACAC
TTGGATCGCCTCGGGAAGCGGCGTCCACATTCTCCTCCTACCGCTTCTGGGGGTGCCTACTATCCGCCTTACCCG
TCCACGTCCAGCTCAGGGCAGGGCGAGGTCCCGTACCGGCAGTTCCCAGAAGACTCCAGCAGTGCACACAATCAA
TACCAGCAGTTTGTGCCACAAGACTACACTGGCTATGTGCCGCCGCCGCCGCCTCCCCCGGGCCCACCGCCACCA
CCAGAGCCAGGCATGAGAGGAGATGGGTACCCGCCTGTGGCACCAGGTATGCCTCCTGGGCCGCCGCCGCCAGCC
GGGCCTCATCCTGGTGAAAACTATCCACCAGACCATGTGAGTGACCATTTCCATCGTCACCATCGCCGAGGCAGA
GGCGCTGCACATGATGGCGTAATGCCCAAAGATGATGACGCGTCGAACCCGGAGACTGCAACGGCGCCAAGATCT
GTCTCGTTTATTCCCCTCTCGCCACGGAGCTCACAGACAATGCAGCGACACAAGGAACAACAAGCAGCTAGCACC
AAGGCTGCTCTTGAACGGACCCGGGACGAAAAAACTGGCATGAAGCGACAAGGCGACCAAACGCACGGCAGGCCT
GGTCTCGAGCGGCAGTCAGGCCATGACCGTGCAGCCGCAAGCCGGCGTGCATTGCCTGAAGGGGAAGACGAGGTG
GAGCTTTTGCCTGACAGGTTCGATGCACAAGGCAAGCCAATGGACACCAGTGGCCGCCTTGTGGGCCATGATGGC
TGGACAATAAGACGCGGTGAGTTTGAGCGGCCGGCTCGACATGCTGGGGATTGGCACGTCAAAGGATCGTGGCAG
GCGGCGAGCACCGATGCCCAAGCCATGGATAGACTGGTGAGCGACGTAACCGACGTGCTGGCGGGACAGCAGAAT
TGGGCGGCGGTGCTGGGCAAGGTGCTCGAGGCAGGACTGCTTTGA
Transcript >OphauG2|6898
ATGGCCGAATCCTACAGAGGCTCGAGATATTACGCTCCGGCCAGAGATCGCGATCGCAACAGCGACTCGGAAGAC
GATCGCATCCGCTCCTCCACCACCGTCACCCGCTACAAGTGGACGCCCGCCCGTGCCGTTGACCGCTACCAAGAC
GACGACCGCCGCTCTCGCTTCTCGCCTCGCACCTCGGGCGACCTGGCCGACCCGCCGCGCTCTGCCTACGAGTCG
TATGCTGGTGACCGCCCTCGTGCAATGTACTACGACCGAGACGTGGTGGAGCGCGATGCTCGCCACGAGCCCGAC
CGCTCTCGACCCGTTTATGAGACCCGCGACGGAGACCGTGACTGGAACCGCCGCCTATACCGCTACGACGACGAC
TACAAGGTTGAGAAAAAGTACGAGGATCGCTTCGACGACGACCATGGCCATGAGATTGAGCGCTACCGCAAGGAG
ACGGAGTATTTCGCCCCTGCCGAACCCCCCCCTGCCCCCGTCATCATCCGCCAGCAGGCTCCCGAGCCTCAAAAG
ATCATTGTCCAAGAGGCCCCATCCACCCCCATCATTGTGCCCCGTCAACAGCCTGGCGTCCTTGTCGTCCGGGAC
CGCGAACAAGACCGTGACCTTGTTCGCCGTGACCGTGAACCCTACGACCAAGAGTACTACTGGCGTCACGAGCGC
CGAGACGTTGGGCCCTACCGTGGCGAGCGCGACTATGCTCTCTCGCGCTATGAGCGCCGCCATCGTCGCGACGAC
GATAACAGCTGGTACAGCGACGACGCCGACCAAGACTACTTTCTCCGCCGCACATACGTCCGCCGAGAGCGCAGT
GAAAGTCCCCATCGCCACCGGCGCCAGCTTGCCGAGGGCGCCCTTGCTGGTGCCGGCATCTCGGCTCTCATGTCG
TCTCGCCGAGACTCGTATGGCGAATTGCAAGAAAACCGCGGCCGCAAAGTCCTGGCCGGCGCTGCGCTGGGTGCC
CTCGGCTCAGAAGCCCTCCGACGTGCTCGGAGTGCTTACGGGGATAGCTGGTTGGACGACCACGCTTCACCAGAG
GGCCACTCACGACTAAGAAGAGGTCTTGGTCTTGCTGCTGTCGCTCTGGCCGCCGCCGGCGCTGCCAAGTACTAC
GAGGCCAGCAAGGTGGAAAAGGAAGAGGCTCACCGCGGCCGCAGCCGGACAAGGGGTGGCTACTACTCCCATGAT
GAGTATTCCCGCTCTGTTTCTCGCCTCTCTCACTCTCACTCTCACTCTCACTCTCCTTCTCCTCGTCGTCCTCGC
TCGCGCCGCCGCAGCCTGTCAACCATTGCCAAGACGGCCCTAGGCACAGCTGCCACGGCTGGAATCATCAAGCAC
ATGAGCAAGTCCAGGTCCAAGTCTCACTCGCGCCACGGCAGCCCCTCTCGGAGCAAGTCTCGTAGCAAGTCGAAG
CTTCGTCGCGGCGCTGAAATTGCTGGCGTTGCCGCTGCTGCTGGCATGGCCAACAGGCTTTGGAAGGACCACAAG
GACAAGAAGGAGGCGCGCCGCGACCGCAGCGTCAGCCAAGACGAGCGCGAATCCCGTCGTCGATGGCGACCCAAG
GGCTCAAGCAGAGATCGCAGCATCAGCCGCAGCCCGAGTCGGAGCAGGTCCATGGCCAGATCCCCTCCGTCACCG
ATAGGGGCTGATCCTGAGCTAGGCTTAGTTGAGTACGGGCACGAGCCTCTGCCGCCGGAGCATCCATCTGCCGCC
GAGCGGCATTATGATTCTCAAAGCGAGGATTGGAGGCCCCGGCCGAGGCGACGCCATGCCCGCTCAGTGTCATCG
TCGTCGTCCATGTCGGACCCGAAACCGAAGCCAAGACACAGCAGAAGCAAAATGGCTGCCGCTGCCACTGCCGCT
GCGGCAGCTGGCACGGCCGCCATGGGCATCAAGGAATTCAAGGATCGAAAGGATAGGGAGAGGCGGGAGAAGAGG
TCACGCGAAAGGAGATCGAGAGAGGCAGACGAGGACAGGACAAGATTCGAATCAGAGCAGAGGCGCGACCAACAC
TTGGATCGCCTCGGGAAGCGGCGTCCACATTCTCCTCCTACCGCTTCTGGGGGTGCCTACTATCCGCCTTACCCG
TCCACGTCCAGCTCAGGGCAGGGCGAGGTCCCGTACCGGCAGTTCCCAGAAGACTCCAGCAGTGCACACAATCAA
TACCAGCAGTTTGTGCCACAAGACTACACTGGCTATGTGCCGCCGCCGCCGCCTCCCCCGGGCCCACCGCCACCA
CCAGAGCCAGGCATGAGAGGAGATGGGTACCCGCCTGTGGCACCAGGTATGCCTCCTGGGCCGCCGCCGCCAGCC
GGGCCTCATCCTGGTGAAAACTATCCACCAGACCATGTGAGTGACCATTTCCATCGTCACCATCGCCGAGGCAGA
GGCGCTGCACATGATGGCGTAATGCCCAAAGATGATGACGCGTCGAACCCGGAGACTGCAACGGCGCCAAGATCT
GTCTCGTTTATTCCCCTCTCGCCACGGAGCTCACAGACAATGCAGCGACACAAGGAACAACAAGCAGCTAGCACC
AAGGCTGCTCTTGAACGGACCCGGGACGAAAAAACTGGCATGAAGCGACAAGGCGACCAAACGCACGGCAGGCCT
GGTCTCGAGCGGCAGTCAGGCCATGACCGTGCAGCCGCAAGCCGGCGTGCATTGCCTGAAGGGGAAGACGAGGTG
GAGCTTTTGCCTGACAGGTTCGATGCACAAGGCAAGCCAATGGACACCAGTGGCCGCCTTGTGGGCCATGATGGC
TGGACAATAAGACGCGGTGAGTTTGAGCGGCCGGCTCGACATGCTGGGGATTGGCACGTCAAAGGATCGTGGCAG
GCGGCGAGCACCGATGCCCAAGCCATGGATAGACTGGTGAGCGACGTAACCGACGTGCTGGCGGGACAGCAGAAT
TGGGCGGCGGTGCTGGGCAAGGTGCTCGAGGCAGGACTGCTTTGA
Gene >OphauG2|6898
ATGGCCGAATCCTACAGAGGCTCGAGATATTACGCTCCGGCCAGAGATCGCGATCGCAACAGCGACTCGGAAGAC
GATCGCATCCGCTCCTCCACCACCGTCACCCGCTACAAGTGGACGCCCGCCCGTGCCGTTGACCGCTACCAAGAC
GACGACCGCCGCTCTCGCTTCTCGCCTCGCACCTCGGGCGACCTGGCCGACCCGCCGCGCTCTGCCTACGAGTCG
TATGCTGGTGACCGCCCTCGTGCAATGTACTACGACCGAGACGTGGTGGAGCGCGATGCTCGCCACGAGCCCGAC
CGCTCTCGACCCGTTTATGAGACCCGCGACGGAGACCGTGACTGGAACCGCCGCCTATACCGCTACGACGACGAC
TACAAGGTTGAGAAAAAGTACGAGGATCGCTTCGACGACGACCATGGCCATGAGATTGAGCGCTACCGCAAGGAG
ACGGAGTATTTCGCCCCTGCCGAACCCCCCCCTGCCCCCGTCATCATCCGCCAGCAGGCTCCCGAGCCTCAAAAG
ATCATTGTCCAAGAGGCCCCATCCACCCCCATCATTGTGCCCCGTCAACAGCCTGGCGTCCTTGTCGTCCGGGAC
CGCGAACAAGACCGTGACCTTGTTCGCCGTGACCGTGAACCCTACGACCAAGAGTACTACTGGCGTCACGAGCGC
CGAGACGTTGGGCCCTACCGTGGCGAGCGCGACTATGCTCTCTCGCGCTATGAGCGCCGCCATCGTCGCGACGAC
GATAACAGCTGGTACAGCGACGACGCCGACCAAGACTACTTTCTCCGCCGCACATACGTCCGCCGAGAGCGCAGT
GAAAGTCCCCATCGCCACCGGCGCCAGCTTGCCGAGGGCGCCCTTGCTGGTGCCGGCATCTCGGCTCTCATGTCG
TCTCGCCGAGACTCGTATGGCGAATTGCAAGAAAACCGCGGCCGCAAAGTCCTGGCCGGCGCTGCGCTGGGTGCC
CTCGGCTCAGAAGCCCTCCGACGTGCTCGGAGTGCTTACGGGGATAGCTGGTTGGACGACCACGCTTCACCAGAG
GGCCACTCACGACTAAGAAGAGGTCTTGGTCTTGCTGCTGTCGCTCTGGCCGCCGCCGGCGCTGCCAAGTACTAC
GAGGCCAGCAAGGTGGAAAAGGAAGAGGCTCACCGCGGCCGCAGCCGGACAAGGGGTGGCTACTACTCCCATGAT
GAGTATTCCCGCTCTGTTTCTCGCCTCTCTCACTCTCACTCTCACTCTCACTCTCCTTCTCCTCGTCGTCCTCGC
TCGCGCCGCCGCAGCCTGTCAACCATTGCCAAGACGGCCCTAGGCACAGCTGCCACGGCTGGAATCATCAAGCAC
ATGAGCAAGTCCAGGTCCAAGTCTCACTCGCGCCACGGCAGCCCCTCTCGGAGCAAGTCTCGTAGCAAGTCGAAG
CTTCGTCGCGGCGCTGAAATTGCTGGCGTTGCCGCTGCTGCTGGCATGGCCAACAGGCTTTGGAAGGACCACAAG
GACAAGAAGGAGGCGCGCCGCGACCGCAGCGTCAGCCAAGACGAGCGCGAATCCCGTCGTCGATGGCGACCCAAG
GGCTCAAGCAGAGATCGCAGCATCAGCCGCAGCCCGAGTCGGAGCAGGTCCATGGCCAGATCCCCTCCGTCACCG
ATAGGGGCTGATCCTGAGCTAGGCTTAGTTGAGTACGGGCACGAGCCTCTGCCGCCGGAGCATCCATCTGCCGCC
GAGCGGCATTATGATTCTCAAAGCGAGGATTGGAGGCCCCGGCCGAGGCGACGCCATGCCCGCTCAGTGTCATCG
TCGTCGTCCATGTCGGACCCGAAACCGAAGCCAAGACACAGCAGAAGCAAAATGGCTGCCGCTGCCACTGCCGCT
GCGGCAGCTGGCACGGCCGCCATGGGCATCAAGGAATTCAAGGATCGAAAGGATAGGGAGAGGCGGGAGAAGAGG
TCACGCGAAAGGAGATCGAGAGAGGCAGACGAGGACAGGACAAGTAAGACACCCCTATAGCCCAGACCTGGAAGG
CGCCCTCAGCAGCTGACTGTTTCTGCCAGGATTCGAATCAGAGCAGAGGCGCGACCAACACTTGGATCGCCTCGG
GAAGCGGCGTCCACATTCTCCTCCTACCGCTTCTGGGGGTGCCTACTATCCGCCTTACCCGTCCACGTCCAGCTC
AGGGCAGGGCGAGGTCCCGTACCGGCAGTTCCCAGAAGACTCCAGCAGTGCACACAATCAATACCAGCAGTTTGT
GCCACAAGACTACACTGGCTATGTGCCGCCGCCGCCGCCTCCCCCGGGCCCACCGCCACCACCAGAGCCAGGCAT
GAGAGGAGATGGGTACCCGCCTGTGGCACCAGGTATGCCTCCTGGGCCGCCGCCGCCAGCCGGGCCTCATCCTGG
TGAAAACTATCCACCAGACCATGTGAGTGACCATTTCCATCGTCACCATCGCCGAGGCAGAGGCGCTGCACATGG
TGCGTCGACTAGTGCTTCGCGGGCCCCTTGTTCATATAGAGGCGGCAGCTGATGTTATTCTAGATGGCGTAATGC
CCAAAGATGATGACGCGTCGAACCCGGAGACTGCAACGGCGCCAAGATCTGTCTCGTTTATTCCCCTCTCGCCAC
GGAGCTCACAGACAATGCAGCGACACAAGGAACAACAAGCAGCTAGCACCAAGGCTGCTCTTGAACGGACCCGGG
ACGAAAAAACTGGCATGAAGCGACAAGGCGACCAAACGCACGGCAGGCCTGGTCTCGAGCGGCAGTCAGGCCATG
ACCGTGCAGCCGCAAGCCGGCGTGCATTGCCTGAAGGGGAAGACGAGGTGGAGCTTTTGCCTGACAGGTTCGATG
CACAAGGCAAGCCAATGGACACCAGTGGCCGCCTTGTGGGCCATGATGGCTGGACAATAAGACGCGGTGAGTTTG
AGCGGCCGGCTCGACATGCTGGGGATTGGCACGTCAAAGGATCGTGGCAGGCGGCGAGCACCGATGCCCAAGCCA
TGGATAGACTGGTGAGCGACGTAACCGACGTGCTGGCGGGACAGCAGAATTGGGCGGCGGTGCTGGGCAAGGTGC
TCGAGGCAGGACTGCTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail