Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|689
Gene name
LocationContig_1175:3536..4610
Strand+
Gene length (bp)1074
Transcript length (bp)1074
Coding sequence length (bp)1074
Protein length (aa) 358

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00134 Cyclin_N Cyclin, N-terminal domain 2.7E-14 69 185
PF08613 Cyclin Cyclin 5.4E-07 94 184

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P24867|PCL1_YEAST PHO85 cyclin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCL1 PE=1 SV=1 15 222 3.0E-34
sp|Q12477|PCL9_YEAST PHO85 cyclin-9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCL9 PE=1 SV=1 15 203 3.0E-33
sp|P25693|PCL2_YEAST PHO85 cyclin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCL2 PE=1 SV=2 12 216 2.0E-28

GO

GO Term Description Terminal node
GO:0000079 regulation of cyclin-dependent protein serine/threonine kinase activity Yes
GO:0019901 protein kinase binding Yes
GO:0031323 regulation of cellular metabolic process No
GO:0050794 regulation of cellular process No
GO:0050790 regulation of catalytic activity No
GO:0019222 regulation of metabolic process No
GO:0001932 regulation of protein phosphorylation No
GO:1904029 regulation of cyclin-dependent protein kinase activity No
GO:0050789 regulation of biological process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0051726 regulation of cell cycle No
GO:0080090 regulation of primary metabolic process No
GO:0043549 regulation of kinase activity No
GO:0008150 biological_process No
GO:0042325 regulation of phosphorylation No
GO:0019899 enzyme binding No
GO:0065009 regulation of molecular function No
GO:0051338 regulation of transferase activity No
GO:0071900 regulation of protein serine/threonine kinase activity No
GO:0019900 kinase binding No
GO:0045859 regulation of protein kinase activity No
GO:0065007 biological regulation No
GO:0005488 binding No
GO:0031399 regulation of protein modification process No
GO:0003674 molecular_function No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0051246 regulation of protein metabolic process No
GO:0019220 regulation of phosphate metabolic process No
GO:0051174 regulation of phosphorus metabolic process No
GO:0005515 protein binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3117
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|689 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7059
Ophiocordyceps camponoti-floridani Ophcf2|01173
Ophiocordyceps camponoti-rufipedis Ophun1|6050
Ophiocordyceps kimflemingae Ophio5|493
Ophiocordyceps subramaniannii Hirsu2|5460

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|689
MACSTMTLDELNKAALDQFVYQPVTRDMVSYLAQAARNVIACDSTLVPASPWPKPPPSHNNHSLPPTPPRSPDMA
DDARLPSLDAFITQLVVSSNVQVPTLMSTLVYLGRLKSKLQPMARGLRCTTHRIFLASLILAAKYLNDSSPKNKH
WASYTRIAELQFGFGRTEVNLMEKQLLFLLDWELRITDQDLYRHLDFFLHPLRLRIAERHARKVRHRDEKRRHHD
AAYARYPSPVSSRASSRSRHVTPDLTTRHLHDHGHAATPPGLTYSSSASSCGSVTSLSYSQHSRSATPPDPALYD
SPVQLVVVDDAHQGSSAKRLLSYDSIDQYPQLSQDSGKKRSRRGMWGRLLAGAVAVR*
Coding >OphauG2|689
ATGGCCTGCTCAACCATGACGCTCGACGAGCTCAACAAGGCTGCCCTCGACCAATTCGTCTACCAGCCCGTCACC
CGCGACATGGTGTCGTATCTGGCCCAGGCCGCCCGCAATGTCATTGCCTGCGATTCCACCCTCGTGCCCGCCTCG
CCCTGGCCCAAGCCGCCGCCCTCGCACAACAACCACAGCCTGCCTCCCACGCCCCCTCGAAGCCCCGACATGGCC
GACGACGCCCGCCTGCCGTCGCTCGATGCCTTCATCACGCAGCTGGTGGTGTCGTCCAACGTGCAGGTGCCCACG
CTCATGTCGACGCTCGTCTACTTGGGCCGCCTCAAGTCCAAGCTCCAGCCCATGGCCCGCGGCCTGCGCTGCACC
ACGCATCGCATCTTCTTGGCCTCGCTCATCCTGGCCGCCAAGTACCTCAACGACAGCTCGCCCAAGAACAAGCAC
TGGGCCAGCTACACGCGCATCGCCGAGCTGCAGTTTGGCTTTGGCCGCACCGAGGTCAACCTGATGGAGAAGCAG
CTGCTCTTCCTCCTCGACTGGGAGCTGCGCATCACGGACCAGGACCTGTACCGCCACCTCGACTTCTTCCTGCAC
CCTCTGCGCCTTCGCATCGCTGAGCGCCATGCCCGCAAGGTGCGCCACCGCGACGAGAAGCGCCGCCACCACGAC
GCGGCTTATGCCCGCTACCCCAGCCCCGTGTCGTCGAGGGCCTCGTCACGCTCACGCCATGTCACTCCTGACCTC
ACCACCCGTCACCTCCACGACCATGGCCACGCGGCCACGCCACCCGGCCTGACGTATAGCAGCTCCGCCAGCTCG
TGTGGCTCCGTCACCTCGCTGTCATACAGCCAGCACTCGCGCTCAGCCACACCCCCGGACCCGGCCCTCTATGAC
TCGCCCGTCCAGCTCGTTGTTGTCGACGACGCTCATCAGGGCTCATCAGCCAAGCGCCTTTTGTCGTACGACTCA
ATCGACCAGTACCCCCAACTGTCCCAAGACAGCGGGAAGAAGCGAAGCCGACGCGGCATGTGGGGAAGGCTGTTG
GCCGGCGCTGTTGCTGTGCGGTGA
Transcript >OphauG2|689
ATGGCCTGCTCAACCATGACGCTCGACGAGCTCAACAAGGCTGCCCTCGACCAATTCGTCTACCAGCCCGTCACC
CGCGACATGGTGTCGTATCTGGCCCAGGCCGCCCGCAATGTCATTGCCTGCGATTCCACCCTCGTGCCCGCCTCG
CCCTGGCCCAAGCCGCCGCCCTCGCACAACAACCACAGCCTGCCTCCCACGCCCCCTCGAAGCCCCGACATGGCC
GACGACGCCCGCCTGCCGTCGCTCGATGCCTTCATCACGCAGCTGGTGGTGTCGTCCAACGTGCAGGTGCCCACG
CTCATGTCGACGCTCGTCTACTTGGGCCGCCTCAAGTCCAAGCTCCAGCCCATGGCCCGCGGCCTGCGCTGCACC
ACGCATCGCATCTTCTTGGCCTCGCTCATCCTGGCCGCCAAGTACCTCAACGACAGCTCGCCCAAGAACAAGCAC
TGGGCCAGCTACACGCGCATCGCCGAGCTGCAGTTTGGCTTTGGCCGCACCGAGGTCAACCTGATGGAGAAGCAG
CTGCTCTTCCTCCTCGACTGGGAGCTGCGCATCACGGACCAGGACCTGTACCGCCACCTCGACTTCTTCCTGCAC
CCTCTGCGCCTTCGCATCGCTGAGCGCCATGCCCGCAAGGTGCGCCACCGCGACGAGAAGCGCCGCCACCACGAC
GCGGCTTATGCCCGCTACCCCAGCCCCGTGTCGTCGAGGGCCTCGTCACGCTCACGCCATGTCACTCCTGACCTC
ACCACCCGTCACCTCCACGACCATGGCCACGCGGCCACGCCACCCGGCCTGACGTATAGCAGCTCCGCCAGCTCG
TGTGGCTCCGTCACCTCGCTGTCATACAGCCAGCACTCGCGCTCAGCCACACCCCCGGACCCGGCCCTCTATGAC
TCGCCCGTCCAGCTCGTTGTTGTCGACGACGCTCATCAGGGCTCATCAGCCAAGCGCCTTTTGTCGTACGACTCA
ATCGACCAGTACCCCCAACTGTCCCAAGACAGCGGGAAGAAGCGAAGCCGACGCGGCATGTGGGGAAGGCTGTTG
GCCGGCGCTGTTGCTGTGCGGTGA
Gene >OphauG2|689
ATGGCCTGCTCAACCATGACGCTCGACGAGCTCAACAAGGCTGCCCTCGACCAATTCGTCTACCAGCCCGTCACC
CGCGACATGGTGTCGTATCTGGCCCAGGCCGCCCGCAATGTCATTGCCTGCGATTCCACCCTCGTGCCCGCCTCG
CCCTGGCCCAAGCCGCCGCCCTCGCACAACAACCACAGCCTGCCTCCCACGCCCCCTCGAAGCCCCGACATGGCC
GACGACGCCCGCCTGCCGTCGCTCGATGCCTTCATCACGCAGCTGGTGGTGTCGTCCAACGTGCAGGTGCCCACG
CTCATGTCGACGCTCGTCTACTTGGGCCGCCTCAAGTCCAAGCTCCAGCCCATGGCCCGCGGCCTGCGCTGCACC
ACGCATCGCATCTTCTTGGCCTCGCTCATCCTGGCCGCCAAGTACCTCAACGACAGCTCGCCCAAGAACAAGCAC
TGGGCCAGCTACACGCGCATCGCCGAGCTGCAGTTTGGCTTTGGCCGCACCGAGGTCAACCTGATGGAGAAGCAG
CTGCTCTTCCTCCTCGACTGGGAGCTGCGCATCACGGACCAGGACCTGTACCGCCACCTCGACTTCTTCCTGCAC
CCTCTGCGCCTTCGCATCGCTGAGCGCCATGCCCGCAAGGTGCGCCACCGCGACGAGAAGCGCCGCCACCACGAC
GCGGCTTATGCCCGCTACCCCAGCCCCGTGTCGTCGAGGGCCTCGTCACGCTCACGCCATGTCACTCCTGACCTC
ACCACCCGTCACCTCCACGACCATGGCCACGCGGCCACGCCACCCGGCCTGACGTATAGCAGCTCCGCCAGCTCG
TGTGGCTCCGTCACCTCGCTGTCATACAGCCAGCACTCGCGCTCAGCCACACCCCCGGACCCGGCCCTCTATGAC
TCGCCCGTCCAGCTCGTTGTTGTCGACGACGCTCATCAGGGCTCATCAGCCAAGCGCCTTTTGTCGTACGACTCA
ATCGACCAGTACCCCCAACTGTCCCAAGACAGCGGGAAGAAGCGAAGCCGACGCGGCATGTGGGGAAGGCTGTTG
GCCGGCGCTGTTGCTGTGCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail