Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6841
Gene name
LocationContig_74:15244..16992
Strand-
Gene length (bp)1748
Transcript length (bp)1698
Coding sequence length (bp)1698
Protein length (aa) 566

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 8.2E-10 206 250
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 1.1E-05 258 326
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 7.0E-09 209 269

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q05950|REB1_KLULA DNA-binding protein REB1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=REB1 PE=3 SV=2 176 428 6.0E-26
sp|Q12457|NSI1_YEAST RNA polymerase I termination factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSI1 PE=1 SV=1 127 432 2.0E-25
sp|P21538|REB1_YEAST DNA-binding protein REB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REB1 PE=1 SV=2 176 305 7.0E-17
sp|Q9P6H9|REB1_SCHPO DNA-binding protein reb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=reb1 PE=3 SV=1 129 416 2.0E-15
sp|Q9UUI6|RTF_SCHPO Replication termination factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rtf1 PE=1 SV=2 140 365 4.0E-12

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3162
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6841 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4527
Ophiocordyceps camponoti-floridani Ophcf2|03127
Ophiocordyceps camponoti-rufipedis Ophun1|3838
Ophiocordyceps kimflemingae Ophio5|3071
Ophiocordyceps subramaniannii Hirsu2|5617

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6841
MNDESPRPSLEARQDAPESMDTGEHEDASTSPRLTRSSRKRAKPTYFEQPPEVETFTAENQGLEGLASSPELTPK
SRKRSRTSGSKSNRDKKRGRQSIAQSADGNLVDDIEGQSTQTPRRSHRDGFIHGRFSDQELSHISNTVISFRNEH
GMTQEEVNDMIQAPGGTTAGDAHAQLWSRIFAVCPDRHRQKVINITRKKFHNFVARGTWTQEQDAELSDLIAIHG
PKWSKIAGLINRHPEDLRDRYRNYLVCGTNQRKDAWDEMEEARLTQFVIEAMASIDDLRQSEPDREILRRSYEDL
IDWQNISERMNRTRSRLQCITKWKSLNLRTHGKDRLVSREPNSQISFRLEKARRQIQAMPDEERLRLLLAIHATS
VGKDSKIPWTRLIDKHFRNQWQRSTQILLWQRLKQTVPEWETRTTRDCAQYLVEQYNQTGTLPDLRAEGYDDALE
MELLKSKAASSTRSSGACVSKEHANTKSAAIVENSDDDDDDKNAPHSNAGEMGLDAISQAVSENLPDILAETIAE
PDNMVERAVETIQDAAQQTMAQMMPVEMHDDDLKVDPALT*
Coding >OphauG2|6841
ATGAACGACGAATCACCCAGGCCCAGCCTGGAAGCCCGACAAGACGCCCCCGAGTCCATGGACACGGGTGAGCAT
GAAGATGCATCAACATCGCCCAGACTGACGCGGTCAAGTCGGAAAAGAGCCAAGCCGACATACTTTGAACAGCCG
CCGGAAGTGGAGACTTTTACCGCGGAGAACCAAGGCTTGGAAGGCTTGGCCTCTTCGCCAGAGCTGACGCCAAAG
TCTCGCAAAAGGTCCAGGACGTCAGGGTCCAAGTCCAATCGGGACAAAAAGCGAGGCAGACAAAGCATCGCACAG
TCTGCCGACGGCAACCTTGTGGATGATATAGAGGGCCAGAGCACGCAGACGCCGCGTCGGAGTCATCGCGACGGC
TTCATCCACGGCCGCTTCTCAGACCAGGAGCTGTCGCATATTTCAAATACAGTCATTTCATTCAGAAACGAGCAT
GGCATGACTCAAGAAGAAGTCAATGATATGATACAGGCCCCGGGAGGAACGACAGCCGGCGACGCTCATGCTCAG
CTCTGGTCGCGCATTTTTGCAGTCTGCCCCGATCGTCATCGACAAAAGGTGATCAACATTACGCGGAAAAAATTC
CACAACTTTGTTGCGCGTGGAACGTGGACGCAGGAGCAAGACGCTGAGCTGTCTGACTTGATTGCTATTCATGGC
CCCAAATGGTCCAAGATTGCTGGCCTTATCAACCGTCATCCAGAAGACCTACGAGACCGGTACCGCAACTACCTC
GTATGCGGCACCAATCAGCGAAAGGACGCCTGGGACGAGATGGAGGAGGCGCGGCTTACCCAATTCGTCATTGAA
GCCATGGCGTCGATTGACGACCTTCGCCAGTCGGAGCCTGACCGAGAAATCCTCCGACGGTCATATGAGGATCTA
ATAGACTGGCAAAACATTAGCGAACGGATGAACCGAACGCGCAGCCGATTGCAGTGCATCACCAAGTGGAAGTCT
TTAAATCTGCGTACACATGGAAAGGATAGGTTGGTTTCGCGCGAGCCCAACTCGCAGATTTCATTCCGGCTGGAA
AAGGCAAGACGTCAAATACAAGCCATGCCCGACGAAGAAAGGCTCCGATTACTGCTGGCCATTCATGCAACGTCA
GTGGGCAAAGATTCCAAGATTCCTTGGACGCGTTTGATCGACAAGCACTTTCGCAATCAGTGGCAACGCTCCACG
CAAATCCTCCTGTGGCAACGTCTAAAGCAGACAGTGCCTGAATGGGAGACGCGGACGACACGTGACTGCGCGCAA
TATTTGGTGGAACAGTACAACCAAACGGGCACCCTGCCCGATCTCAGAGCCGAGGGATACGATGATGCGCTGGAA
ATGGAACTTCTCAAATCAAAGGCAGCCTCATCCACTCGGTCCAGCGGTGCCTGCGTCTCCAAGGAACATGCCAAC
ACCAAGAGTGCGGCCATTGTTGAGAACTCTGACGACGACGACGACGACAAGAATGCGCCCCACAGCAATGCGGGC
GAGATGGGCTTGGATGCAATCTCGCAGGCGGTATCGGAGAACTTGCCTGACATACTGGCCGAGACGATTGCAGAA
CCTGACAACATGGTGGAGAGAGCTGTAGAGACGATTCAAGACGCAGCTCAGCAGACCATGGCACAGATGATGCCT
GTTGAAATGCACGACGACGACCTCAAGGTAGATCCTGCATTGACATGA
Transcript >OphauG2|6841
ATGAACGACGAATCACCCAGGCCCAGCCTGGAAGCCCGACAAGACGCCCCCGAGTCCATGGACACGGGTGAGCAT
GAAGATGCATCAACATCGCCCAGACTGACGCGGTCAAGTCGGAAAAGAGCCAAGCCGACATACTTTGAACAGCCG
CCGGAAGTGGAGACTTTTACCGCGGAGAACCAAGGCTTGGAAGGCTTGGCCTCTTCGCCAGAGCTGACGCCAAAG
TCTCGCAAAAGGTCCAGGACGTCAGGGTCCAAGTCCAATCGGGACAAAAAGCGAGGCAGACAAAGCATCGCACAG
TCTGCCGACGGCAACCTTGTGGATGATATAGAGGGCCAGAGCACGCAGACGCCGCGTCGGAGTCATCGCGACGGC
TTCATCCACGGCCGCTTCTCAGACCAGGAGCTGTCGCATATTTCAAATACAGTCATTTCATTCAGAAACGAGCAT
GGCATGACTCAAGAAGAAGTCAATGATATGATACAGGCCCCGGGAGGAACGACAGCCGGCGACGCTCATGCTCAG
CTCTGGTCGCGCATTTTTGCAGTCTGCCCCGATCGTCATCGACAAAAGGTGATCAACATTACGCGGAAAAAATTC
CACAACTTTGTTGCGCGTGGAACGTGGACGCAGGAGCAAGACGCTGAGCTGTCTGACTTGATTGCTATTCATGGC
CCCAAATGGTCCAAGATTGCTGGCCTTATCAACCGTCATCCAGAAGACCTACGAGACCGGTACCGCAACTACCTC
GTATGCGGCACCAATCAGCGAAAGGACGCCTGGGACGAGATGGAGGAGGCGCGGCTTACCCAATTCGTCATTGAA
GCCATGGCGTCGATTGACGACCTTCGCCAGTCGGAGCCTGACCGAGAAATCCTCCGACGGTCATATGAGGATCTA
ATAGACTGGCAAAACATTAGCGAACGGATGAACCGAACGCGCAGCCGATTGCAGTGCATCACCAAGTGGAAGTCT
TTAAATCTGCGTACACATGGAAAGGATAGGTTGGTTTCGCGCGAGCCCAACTCGCAGATTTCATTCCGGCTGGAA
AAGGCAAGACGTCAAATACAAGCCATGCCCGACGAAGAAAGGCTCCGATTACTGCTGGCCATTCATGCAACGTCA
GTGGGCAAAGATTCCAAGATTCCTTGGACGCGTTTGATCGACAAGCACTTTCGCAATCAGTGGCAACGCTCCACG
CAAATCCTCCTGTGGCAACGTCTAAAGCAGACAGTGCCTGAATGGGAGACGCGGACGACACGTGACTGCGCGCAA
TATTTGGTGGAACAGTACAACCAAACGGGCACCCTGCCCGATCTCAGAGCCGAGGGATACGATGATGCGCTGGAA
ATGGAACTTCTCAAATCAAAGGCAGCCTCATCCACTCGGTCCAGCGGTGCCTGCGTCTCCAAGGAACATGCCAAC
ACCAAGAGTGCGGCCATTGTTGAGAACTCTGACGACGACGACGACGACAAGAATGCGCCCCACAGCAATGCGGGC
GAGATGGGCTTGGATGCAATCTCGCAGGCGGTATCGGAGAACTTGCCTGACATACTGGCCGAGACGATTGCAGAA
CCTGACAACATGGTGGAGAGAGCTGTAGAGACGATTCAAGACGCAGCTCAGCAGACCATGGCACAGATGATGCCT
GTTGAAATGCACGACGACGACCTCAAGGTAGATCCTGCATTGACATGA
Gene >OphauG2|6841
ATGAACGACGAATCACCCAGGCCCAGCCTGGAAGCCCGACAAGACGCCCCCGAGTCCATGGACACGGGTGAGCAT
GAAGATGCATCAACATCGCCCAGACTGACGCGGTCAAGTCGGAAAAGAGCCAAGCCGACATACTTTGAACAGCCG
CCGGAAGTGGAGACTTTTACCGCGGAGAACCAAGGCTTGGAAGGCTTGGCCTCTTCGCCAGAGCTGACGCCAAAG
TCTCGCAAAAGGTCCAGGACGTCAGGGTCCAAGTCCAATCGGGACAAAAAGCGAGGCAGACAAAGCATCGCACAG
TCTGCCGACGGCAACCTTGTGGATGATATAGAGGGCCAGAGCACGCAGACGCCGCGTCGGAGTCATCGCGACGGC
TTCATCCACGGCCGCTTCTCAGACCAGGAGCTGTCGCATATTTCAAATACAGTCATTTCATTCAGAAACGAGCAT
GGCATGACTCAAGAAGAAGTCAATGATGTAAGTCTGTTGGGCTCTTCTCTCAATGGCGCTCGCTGAGACTGGTCC
AGATGATACAGGCCCCGGGAGGAACGACAGCCGGCGACGCTCATGCTCAGCTCTGGTCGCGCATTTTTGCAGTCT
GCCCCGATCGTCATCGACAAAAGGTGATCAACATTACGCGGAAAAAATTCCACAACTTTGTTGCGCGTGGAACGT
GGACGCAGGAGCAAGACGCTGAGCTGTCTGACTTGATTGCTATTCATGGCCCCAAATGGTCCAAGATTGCTGGCC
TTATCAACCGTCATCCAGAAGACCTACGAGACCGGTACCGCAACTACCTCGTATGCGGCACCAATCAGCGAAAGG
ACGCCTGGGACGAGATGGAGGAGGCGCGGCTTACCCAATTCGTCATTGAAGCCATGGCGTCGATTGACGACCTTC
GCCAGTCGGAGCCTGACCGAGAAATCCTCCGACGGTCATATGAGGATCTAATAGACTGGCAAAACATTAGCGAAC
GGATGAACCGAACGCGCAGCCGATTGCAGTGCATCACCAAGTGGAAGTCTTTAAATCTGCGTACACATGGAAAGG
ATAGGTTGGTTTCGCGCGAGCCCAACTCGCAGATTTCATTCCGGCTGGAAAAGGCAAGACGTCAAATACAAGCCA
TGCCCGACGAAGAAAGGCTCCGATTACTGCTGGCCATTCATGCAACGTCAGTGGGCAAAGATTCCAAGATTCCTT
GGACGCGTTTGATCGACAAGCACTTTCGCAATCAGTGGCAACGCTCCACGCAAATCCTCCTGTGGCAACGTCTAA
AGCAGACAGTGCCTGAATGGGAGACGCGGACGACACGTGACTGCGCGCAATATTTGGTGGAACAGTACAACCAAA
CGGGCACCCTGCCCGATCTCAGAGCCGAGGGATACGATGATGCGCTGGAAATGGAACTTCTCAAATCAAAGGCAG
CCTCATCCACTCGGTCCAGCGGTGCCTGCGTCTCCAAGGAACATGCCAACACCAAGAGTGCGGCCATTGTTGAGA
ACTCTGACGACGACGACGACGACAAGAATGCGCCCCACAGCAATGCGGGCGAGATGGGCTTGGATGCAATCTCGC
AGGCGGTATCGGAGAACTTGCCTGACATACTGGCCGAGACGATTGCAGAACCTGACAACATGGTGGAGAGAGCTG
TAGAGACGATTCAAGACGCAGCTCAGCAGACCATGGCACAGATGATGCCTGTTGAAATGCACGACGACGACCTCA
AGGTAGATCCTGCATTGACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail