Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6821
Gene name
LocationContig_736:4473..5426
Strand-
Gene length (bp)953
Transcript length (bp)846
Coding sequence length (bp)846
Protein length (aa) 282

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase 2.2E-08 4 182

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q48KH5|TAL_PSE14 Transaldolase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tal PE=3 SV=1 3 182 3.0E-07
sp|Q2RUN7|TAL_RHORT Transaldolase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=tal PE=3 SV=1 1 213 4.0E-07
sp|A1WIS6|TAL_VEREI Transaldolase OS=Verminephrobacter eiseniae (strain EF01-2) GN=tal PE=3 SV=1 4 206 2.0E-06

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6821
MARLVSGRLHVQTLPRHTYSVKQTLKSAERLVGLFRLLAPDIKPSRLCINVIASWHGLKVCEVMHNDTTARFQGI
ATRAVATYSTAQILSALYRKCSYIKFLMRPFGASQDVASSPSWSSGPTLASLDRHRIAMIYLAQAHAYKTNTTRV
TAASISSSWDATDLAGIDHVGLTKDHLSRLVQSFDYLPGLECQSASLPRVLYGQSSSSSLLQREQDRIDPLRDEE
DYALWLPRHFASNHGSDAIDFQRALTFFCRAQNDLEQIIISLQDVNYDDDDVASWC*
Coding >OphauG2|6821
ATGGCTCGTCTTGTCAGCGGCCGGCTTCACGTGCAGACGCTGCCCAGGCATACTTATTCGGTCAAACAAACGCTC
AAGAGCGCCGAGAGACTCGTCGGCCTCTTTCGACTGCTGGCACCAGACATTAAGCCCTCGAGGCTCTGCATCAAC
GTCATTGCCTCTTGGCACGGGCTCAAGGTGTGCGAAGTGATGCACAATGACACTACAGCCCGCTTTCAAGGCATT
GCTACGCGCGCAGTAGCCACGTACAGCACGGCCCAGATCCTCTCGGCCCTCTACCGCAAATGCAGCTACATCAAG
TTTTTGATGCGCCCGTTTGGAGCCAGCCAAGACGTTGCATCATCACCGTCATGGTCATCAGGGCCCACACTCGCC
TCGCTTGACCGGCATCGCATCGCCATGATTTACCTGGCCCAAGCCCACGCCTACAAAACCAACACGACGCGCGTC
ACAGCCGCATCCATCTCGTCGTCGTGGGACGCCACGGATCTGGCGGGCATTGACCACGTCGGGCTGACAAAGGAC
CACTTGAGCCGCCTGGTGCAGAGCTTTGACTATCTTCCAGGACTCGAGTGCCAGTCTGCGTCACTGCCTCGAGTC
CTTTACGGCCAGTCGTCGTCGTCGTCGCTGCTGCAGAGGGAGCAGGATCGTATCGATCCTCTGCGAGACGAGGAA
GACTATGCGTTGTGGCTGCCGAGGCATTTCGCTAGCAACCATGGCTCTGACGCCATTGATTTCCAACGCGCTTTG
ACTTTTTTCTGCAGGGCGCAGAATGATTTGGAGCAAATCATTATTTCCCTCCAAGACGTCAATTACGATGATGAT
GATGTTGCTTCTTGGTGCTGA
Transcript >OphauG2|6821
ATGGCTCGTCTTGTCAGCGGCCGGCTTCACGTGCAGACGCTGCCCAGGCATACTTATTCGGTCAAACAAACGCTC
AAGAGCGCCGAGAGACTCGTCGGCCTCTTTCGACTGCTGGCACCAGACATTAAGCCCTCGAGGCTCTGCATCAAC
GTCATTGCCTCTTGGCACGGGCTCAAGGTGTGCGAAGTGATGCACAATGACACTACAGCCCGCTTTCAAGGCATT
GCTACGCGCGCAGTAGCCACGTACAGCACGGCCCAGATCCTCTCGGCCCTCTACCGCAAATGCAGCTACATCAAG
TTTTTGATGCGCCCGTTTGGAGCCAGCCAAGACGTTGCATCATCACCGTCATGGTCATCAGGGCCCACACTCGCC
TCGCTTGACCGGCATCGCATCGCCATGATTTACCTGGCCCAAGCCCACGCCTACAAAACCAACACGACGCGCGTC
ACAGCCGCATCCATCTCGTCGTCGTGGGACGCCACGGATCTGGCGGGCATTGACCACGTCGGGCTGACAAAGGAC
CACTTGAGCCGCCTGGTGCAGAGCTTTGACTATCTTCCAGGACTCGAGTGCCAGTCTGCGTCACTGCCTCGAGTC
CTTTACGGCCAGTCGTCGTCGTCGTCGCTGCTGCAGAGGGAGCAGGATCGTATCGATCCTCTGCGAGACGAGGAA
GACTATGCGTTGTGGCTGCCGAGGCATTTCGCTAGCAACCATGGCTCTGACGCCATTGATTTCCAACGCGCTTTG
ACTTTTTTCTGCAGGGCGCAGAATGATTTGGAGCAAATCATTATTTCCCTCCAAGACGTCAATTACGATGATGAT
GATGTTGCTTCTTGGTGCTGA
Gene >OphauG2|6821
ATGGCTCGTCTTGTCAGCGGCCGGCTTCACGTGCAGACGCTGCCCAGGCATACTTATTCGGTCAAACAAACGCTC
AAGAGCGCCGAGAGTAAGAATCCAAGTTTGATTATTTATTTTTGCTCCAAATACTACATCTATAAAGAATACTTG
TGTATAAATTTGTCAAAACCAGCGCTCATGGCTTCACCGTTGCAGGACTCGTCGGCCTCTTTCGACTGCTGGCAC
CAGACATTAAGCCCTCGAGGCTCTGCATCAACGTCATTGCCTCTTGGCACGGGCTCAAGGTGTGCGAAGTGATGC
ACAATGACACTACAGCCCGCTTTCAAGGCATTGCTACGCGCGCAGTAGCCACGTACAGCACGGCCCAGATCCTCT
CGGCCCTCTACCGCAAATGCAGCTACATCAAGTTTTTGATGCGCCCGTTTGGAGCCAGCCAAGACGTTGCATCAT
CACCGTCATGGTCATCAGGGCCCACACTCGCCTCGCTTGACCGGCATCGCATCGCCATGATTTACCTGGCCCAAG
CCCACGCCTACAAAACCAACACGACGCGCGTCACAGCCGCATCCATCTCGTCGTCGTGGGACGCCACGGATCTGG
CGGGCATTGACCACGTCGGGCTGACAAAGGACCACTTGAGCCGCCTGGTGCAGAGCTTTGACTATCTTCCAGGAC
TCGAGTGCCAGTCTGCGTCACTGCCTCGAGTCCTTTACGGCCAGTCGTCGTCGTCGTCGCTGCTGCAGAGGGAGC
AGGATCGTATCGATCCTCTGCGAGACGAGGAAGACTATGCGTTGTGGCTGCCGAGGCATTTCGCTAGCAACCATG
GCTCTGACGCCATTGATTTCCAACGCGCTTTGACTTTTTTCTGCAGGGCGCAGAATGATTTGGAGCAAATCATTA
TTTCCCTCCAAGACGTCAATTACGATGATGATGATGTTGCTTCTTGGTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail