Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6817
Gene name
LocationContig_735:4114..4735
Strand-
Gene length (bp)621
Transcript length (bp)561
Coding sequence length (bp)561
Protein length (aa) 187

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.9E-11 66 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HEQ9|TCG1_SCHPO Single-stranded TG1-3 DNA-binding protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tcg1 PE=1 SV=3 66 158 1.0E-21
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 52 156 1.0E-09
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 61 152 3.0E-08
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 66 149 2.0E-07
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 66 149 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HEQ9|TCG1_SCHPO Single-stranded TG1-3 DNA-binding protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tcg1 PE=1 SV=3 66 158 1.0E-21
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 52 156 1.0E-09
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 61 152 3.0E-08
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 66 149 2.0E-07
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 66 149 2.0E-07
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 47 149 3.0E-07
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 49 154 3.0E-07
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 42 156 4.0E-07
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 66 149 5.0E-07
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 65 157 5.0E-07
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 65 157 5.0E-07
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 66 149 5.0E-07
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 66 149 6.0E-07
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 66 149 6.0E-07
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 66 149 6.0E-07
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 65 157 1.0E-06
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 65 157 1.0E-06
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 65 157 1.0E-06
sp|Q99069|GRP1_SORBI Glycine-rich RNA-binding protein 1 (Fragment) OS=Sorghum bicolor GN=GRP1 PE=2 SV=1 112 152 1.0E-06
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 65 152 1.0E-06
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 42 156 2.0E-06
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 66 149 3.0E-06
sp|Q44554|RBPB_NOSS1 Putative RNA-binding protein RbpB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpB PE=3 SV=3 64 149 3.0E-06
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 65 152 3.0E-06
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 42 152 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6817
MEHATTDAAAAPLGAEGTTEVLPLQDITNKNKTDDNAKNHKNQNRPLRERRERGPPADGIPSKIKVMVANLPYDL
TEERLIELFKAYEPSSAKIALRPIPRFMIKKLQARGEPRKGRGFGFVTLASEELQQKAVAEMNGKEIEGREIAVK
VAIDSPDKTDDDNSPTLGENENVNVEETPATASAAA*
Coding >OphauG2|6817
ATGGAACATGCCACAACTGATGCCGCAGCCGCCCCTCTTGGCGCTGAAGGCACCACTGAGGTGCTTCCACTACAG
GACATTACGAACAAGAACAAGACTGACGACAATGCCAAGAATCACAAGAACCAGAACCGGCCCCTACGTGAACGC
CGAGAGCGTGGTCCTCCCGCGGACGGAATTCCCTCCAAGATTAAGGTCATGGTTGCCAACCTACCGTATGACCTT
ACCGAGGAAAGGCTTATTGAGCTGTTCAAGGCATACGAGCCTTCCTCGGCCAAGATTGCGCTGCGGCCCATTCCT
CGATTTATGATCAAGAAGCTCCAAGCCCGTGGCGAGCCCCGCAAGGGACGTGGCTTTGGATTTGTCACCTTGGCA
TCGGAGGAACTCCAGCAAAAGGCCGTTGCTGAGATGAACGGCAAGGAGATTGAGGGTCGTGAAATTGCCGTCAAG
GTGGCGATTGATAGCCCGGACAAGACAGACGACGATAATTCCCCCACTTTGGGCGAGAATGAAAATGTCAACGTC
GAGGAGACGCCTGCCACGGCCAGTGCCGCTGCCTAG
Transcript >OphauG2|6817
ATGGAACATGCCACAACTGATGCCGCAGCCGCCCCTCTTGGCGCTGAAGGCACCACTGAGGTGCTTCCACTACAG
GACATTACGAACAAGAACAAGACTGACGACAATGCCAAGAATCACAAGAACCAGAACCGGCCCCTACGTGAACGC
CGAGAGCGTGGTCCTCCCGCGGACGGAATTCCCTCCAAGATTAAGGTCATGGTTGCCAACCTACCGTATGACCTT
ACCGAGGAAAGGCTTATTGAGCTGTTCAAGGCATACGAGCCTTCCTCGGCCAAGATTGCGCTGCGGCCCATTCCT
CGATTTATGATCAAGAAGCTCCAAGCCCGTGGCGAGCCCCGCAAGGGACGTGGCTTTGGATTTGTCACCTTGGCA
TCGGAGGAACTCCAGCAAAAGGCCGTTGCTGAGATGAACGGCAAGGAGATTGAGGGTCGTGAAATTGCCGTCAAG
GTGGCGATTGATAGCCCGGACAAGACAGACGACGATAATTCCCCCACTTTGGGCGAGAATGAAAATGTCAACGTC
GAGGAGACGCCTGCCACGGCCAGTGCCGCTGCCTAG
Gene >OphauG2|6817
ATGGAACATGCCACAACTGATGCCGCAGCCGCCCCTCTTGGCGCTGAAGGCACCACTGAGGTGCTTCCACTACAG
GACATTACGAACAAGAACAAGACTGACGACAATGCCAAGAATCACAAGAACCAGAACCGGCCCCTACGTGAACGC
CGAGAGCGTGGTCCTCCCGCGGACGGAATTCCCTCCAAGATTAAGGTCATGGTTGCCAACCTACCGTATGACCTT
ACCGAGGAAAGGGTGAGCAGTCCAAGTCTAGGACAAGTCTTGTTTGACCACGGCTAACGCATTGGTGCCCAGCTT
ATTGAGCTGTTCAAGGCATACGAGCCTTCCTCGGCCAAGATTGCGCTGCGGCCCATTCCTCGATTTATGATCAAG
AAGCTCCAAGCCCGTGGCGAGCCCCGCAAGGGACGTGGCTTTGGATTTGTCACCTTGGCATCGGAGGAACTCCAG
CAAAAGGCCGTTGCTGAGATGAACGGCAAGGAGATTGAGGGTCGTGAAATTGCCGTCAAGGTGGCGATTGATAGC
CCGGACAAGACAGACGACGATAATTCCCCCACTTTGGGCGAGAATGAAAATGTCAACGTCGAGGAGACGCCTGCC
ACGGCCAGTGCCGCTGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail